KEGG   Monodelphis domestica (opossum): 100619840Help
Entry
100619840         CDS       T01031                                 

Gene name
DOT1L
Definition
DOT1-like histone H3K79 methyltransferase
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100619840 (DOT1L)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100619840 (DOT1L)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100619840 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1710 aa AA seqDB search
MDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIH
QLWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQ
MIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWM
KWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRI
VSSKPFAPLNFRINSRNLSGKNLLRFYYIRTILENYFSSLKNPKLREEQEAARRRQQRES
KSNTTTPTKVQENKGAVALEPRMDSGAEEDKNGAAALKKPSPSKPRKKKLNKKGRKMAGR
KRGRPKKMSAANPERKAKKTPTALELLHAQTVSQAAASSPQDAYKSPHSPYYQLPPKVQR
HSSNQLLATPTPPALHKLLESFKVQYLQFLAYMKTPQYKANLQQLVEQEKEKNTQLLGTA
QQLFSHCQAQKEEIKRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLKEQTKQLENDN
SELRNQSLQLLKARCEELKLDWSTLSLENLLKEKQALKNQISEKQKHCLELQISIVELEK
SQRQQELLQLKSYAPADDALSVHLRSKSTFSRELETDPTRFQLELECSKLSLPHISSMSP
ELSMNGHATTYEIHSMLSRPSSKQNTPQYLTSHLDQEIVPCTPIHNNRQKADKLSSLSLP
DYTRFSPAKLALRRHLNQDHVVHGKATTNEIHHRAEHAKENGLTYQSPGISNGLKLSPQE
TRPSSPSALQIAGEKSSDKVLKERAYASNGETITSLPISIPLSTVQPNKLPVSIPLASVV
LPSRAEKVRNTPSPVHQNRESTSATLEKQFGANSHNGMNSAVGNKSLALATSGFSYTGSL
AVNGTLSSSPAHLNHGAEQAALDDSSNSGSLFNSVGSRSSTPQHPSLLMMQSRNSGQNSP
AHPLAASPRLNGASQSLMGILQFSDSTKLFSEGNKGDLPLDSGFSDPENEVKRRILFTIS
TNTGNMKQSPSNKHSPLAASIRADCGQACVQEGKKRGRRKRSSTGNPGANCAVSPKRKPL
PSVAGLFTQSSGSPLNINSMVNNINQPLEITAISSPENSLKNSPIPYQDNDQPPVLKKEK
PLIQTNGAHYSPLTSDEEPGSEDEHNSIRIERKIATISLESKSPQKTENGGGLTGRKQTQ
LTESVNSSKWKSTFSPISDINLTKTSDSPLQAASSLSQNSLFAFRPSSEDTMAIDAKISV
HTRKNFPSSLSGTDGLSPNTNSSNGFSYAGGLSAADMSLHSFHDGASLSHKTTEVASLNS
PLGFQSQRSKDSSDANPFLNKRQLDGLGSMKGEELQRSGGRSKEVLDLGLQLGGPSDKVS
LQHNGKAGKGRDRDLEFKNGHNLFISAAAVPSGGLLNGKGLSTAASTSGHPTSSVSTHHP
FLNTFTTGSQFPLGPMSLQANLSSVAGSSVLQSLFNSMPAAASLVHVSSAATRLTNSHAM
GNFSSGVTGGTVGGVFNHAVPSASSHQFGASFSSSAVCSSTMLSLNPMQAVVTPTSSSFQ
APSSSIGTCSEARAPQPLNRVPVQPVLHPPPAPPLANVSLPPPPPLLAASNPEPGLLQTL
ASIPSNKAFVSPSSAASLQANASLSIKLASLPHKASRPSFTVHHQPLPRLALAQAAPVIP
QSNAAGPPAMWVTLGMQSPYASHLSGVKPR
NT seq 5133 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacaccatgatgctgctcatgaaatcattgagaccattcgatgggtctgtgaa
gaaataccggatctcaagcttgccatggaaaattatgttttaattgactatgataccaaa
agctttgaaagcatgcagagactttgtgacaaatacaaccgagccattgatagcattcat
caactgtggaaaggaacaacccagcccatgaaattgaacactcggccatccaatgggctt
cttcgacatatcttgcaacaagtatataaccactcagtcacagatccagagaaactcaac
aactatgagcccttttctccagaggtgtatggagaaacttcattcgacttagttgcccaa
atgattgatgagattaaaatgaccgaggatgatttgtttgttgatttgggcagtggagtg
ggacaagtggttttgcaagtggccgcagctacaaactgcaagcatcactatggtgtggag
aaagcagacatcccagcgaagtatgctgagacaatggacagagagttcagaaaatggatg
aagtggtatgggaagaagcatgcagaatacacactggaaagaggtgacttcctttcagaa
gaatggcgggaaagaattgcaaatacaagtgttatttttgtgaataattttgcctttggt
cctgaggtggatcaccaactgaaggagcgatttgctaatatgaaggaaggtggcagaatc
gtatcctccaaaccttttgcacctctaaactttagaataaacagtagaaacttgagtggt
aagaatctattaagattttattatattcgaaccatacttgaaaactatttttctagtctc
aaaaatccaaaactcagggaggagcaggaggcagcccgacgccggcaacaaagagaaagc
aaaagtaacacaacaacccccacaaaggtccaagaaaacaagggagctgttgccttggaa
cctcgcatggattctggtgctgaagaagataaaaatggggcggctgctcttaagaagcca
tctccttccaagcctcgaaaaaagaaattaaataagaaaggaaggaagatggcaggaaga
aagcgtgggcgtcccaagaaaatgagtgctgcaaaccctgaacgcaaagccaagaagact
ccaactgccttggaacttctgcatgctcagactgtgtcccaggcagctgcatcctctcct
caggatgcatacaagtcacctcatagtccatattaccaactacctcctaaagtacaacgg
cattcctccaatcagctattggcaacaccaactccgcctgcactccacaagcttttagaa
tcttttaaggttcagtacctgcagttcctggcctacatgaaaacccctcagtacaaggca
aacctgcagcagttggtagagcaggagaaggaaaagaacactcagttgttaggtacagcc
caacagttgttcagccactgtcaggcccagaaagaagagatcaagagattgtttcagcag
aagcttgatgagttgggagtaaaggctctgacctacaatgatctgatacaagctcagaaa
gaaatctctgcccacaaccaacaactaaaagaacagacaaagcaactagaaaatgataac
agtgaactcaggaaccaaagcttgcagctgcttaaggctcggtgtgaagagctaaagctg
gattggtctactctctcactggaaaatttgctgaaggagaagcaggcactgaagaatcaa
atttctgagaagcaaaagcactgtctggagcttcagatcagcattgtggagcttgagaaa
agccaaaggcagcaggagctactgcagctgaagtcctacgcaccggctgatgatgccctg
tccgtccaccttcgaagtaaaagcacttttagcagagagctggagactgaccccacaagg
ttccagctggagcttgaatgctccaagttgtctttgccccacatcagtagcatgagccct
gaactatctatgaatggccatgcaaccacttatgagattcatagtatgctaagccgacct
tcttccaaacaaaacactccacagtacctgacctcccacctggaccaagaaatagttcct
tgcacccccattcataacaacagacagaaggcagacaagttgtcaagtttgtccttacct
gactacaccaggttttcccctgctaagttagctctaaggagacacttgaatcaggatcat
gtagtccatggaaaagctacaactaatgaaatacaccacagagctgaacatgcaaaagag
aatggccttacatatcagagtcctggtatttcaaatggcctaaagctgagccctcaggaa
actcggccttcctccccctcggccttacagattgcaggagagaagagcagtgacaaggtt
ttaaaagagagagcctatgccagcaatggagaaacaatcaccagcctacctatcagtatt
cctctcagcacagtgcagcccaataaacttcctgtcagtatcccattggccagtgtagtg
ttgcctagccgtgcggagaaagtgaggaacacacctagtccagttcatcagaatcgagag
tctacttcagcaacacttgaaaaacagtttggtgctaattcccataatggtatgaacagt
gctgtaggaaacaagtcccttgctttggctacctcaggtttttcttatactggctccttg
gcagttaatggcaccctttccagtagcccagcccatcttaaccatggtgctgagcaggca
gccctagatgattcctctaattcagggagcctctttaattcagtgggttcccggagttct
acaccacaacatccctctttactcatgatgcagtcccgcaactctggccagaactctcca
gcccatccacttgctgccagcccacgtctcaatggagcttctcaaagcctgatggggatc
ttgcagttctcggatagtacaaaattgttctctgaaggtaacaagggggatctcccacta
gattcaggcttttcagatcctgaaaatgaagtcaagagaagaatcctctttacaatctcg
accaatacaggaaacatgaagcagtctccttccaacaaacacagccccctggcagccagc
atccgcgcggattgtggacaggcttgtgtacaggagggcaagaagagaggcaggaggaag
cgatcttctacagggaaccccggagcaaactgtgcagtatctcccaagcgtaagccctta
ccatctgtggcaggcctctttacccagtcttcaggctcacctctgaacatcaactctatg
gtcaataacattaatcagcctttagaaataacagccatttcctcccctgaaaactccctg
aagaactctcctattccttaccaggacaacgaccagcctcccgtgctgaaaaaggagaag
cccttgatccagaccaatggggcacattactcacccttgacctctgatgaagagccagga
tctgaagatgagcacaatagcatcaggattgaaaggaaaattgcaacaatctctttggag
agcaaatctccccagaaaacagaaaatggtggtggccttacgggaaggaagcaaacccag
ctgaccgagagcgtcaacagtagtaaatggaagtctaccttctcaccaatatcagacatc
aaccttaccaaaacatctgacagccccctacaggcagcttcgtccctgagccagaattcc
ctctttgccttccgtccatcctcagaggatacgatggctatcgatgccaagatctctgtg
cacacaaggaaaaacttccccagttcattgtctgggacggatggcctcagccctaacaca
aactcttccaatggattttcatatgccgggggcttgtctgctgctgacatgagtttacac
agctttcacgatggtgcttctctttctcataagactaccgaggtggccagcttaaactct
cccctgggttttcagtcacagcggagcaaagatagctcagatgccaaccctttcctgaac
aagaggcagctggatggtctgggaagtatgaaaggggaagagttacagagatctgggggc
agaagcaaagaggtgctcgacctgggcttgcagctggggggtccttctgacaaggtctcc
ctgcaacacaatggcaaggctggcaaaggacgggaccgggatttggagtttaaaaatggc
cacaatcttttcatttctgctgctgctgttccttctgggggcctcctcaatggcaaaggc
ctttccactgcagcttccacctctggccatcccacttcttccgtttcaacacaccaccct
tttttgaacacttttaccactggatcccagttccccctgggccctatgtccctgcaggcc
aacctcagctcggtggcaggctcctcagtattgcagtctttatttaattccatgcccgct
gctgccagtttggtccacgtgtcatcagctgcgaccagattgacaaattctcacgctatg
ggaaacttctcttctggggttacaggtggaacagttggaggtgtttttaaccatgcggtg
ccttctgcctcttctcatcaatttggagccagtttcagcagcagtgctgtctgtagcagc
accatgctaagcttaaacccaatgcaggctgtggtcacccccacttcctcttccttccag
gccccttcctctagcataggaacatgtagcgaggctcgagcccctcaacccctgaaccga
gtgcccgtgcagcctgttctgcaccctcctcctgctcctcctcttgctaacgtctcatta
cctcccccccctccattactcgctgcttctaacccggagccggggcttctgcagacctta
gcatccattccctctaacaaagcttttgtctcgccctcttcagctgcttctctccaggct
aacgcttctctgtctatcaagctcgcttccctcccccacaaagcttcccgcccttccttc
acagtccaccaccagcctctgccccgtttggccctggcccaggctgcacccgtcatcccg
cagtccaacgccgctggcccacccgctatgtgggttacccttggcatgcagtctccttac
gcttcgcacctttctggggttaagccgcgataa

DBGET integrated database retrieval system