KEGG   Monodelphis domestica (opossum): 100619897Help
Entry
100619897         CDS       T01031                                 

Gene name
G6PC2
Definition
glucose-6-phosphatase, catalytic, 2
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100619897 (G6PC2)
   00052 Galactose metabolism
    100619897 (G6PC2)
   00500 Starch and sucrose metabolism
    100619897 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100619897 (G6PC2)
   04151 PI3K-Akt signaling pathway
    100619897 (G6PC2)
   04152 AMPK signaling pathway
    100619897 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100619897 (G6PC2)
   04920 Adipocytokine signaling pathway
    100619897 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100619897 (G6PC2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100619897 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 173 aa AA seqDB search
MLVAEAFEHTPGTQTANLGTYIKTNLFLVLFCFVLFAFGLYLFLKLLDVDLLWSVFKAKK
WRTNPDWIHMDTTLFAGLVRNLGVLFGLGFASSSEVVFFFLSCQGKDSYKLSFNLLCMMT
SLTLLXLXNFVKIPTHAEYLFYVLSFCQSASIPFTVVAVISYCIHVPREKKIN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtggcagaagcatttgaacatacacctggcacccaaacagcaaatctgggaaca
tatatcaagaccaatctgtttctggttttgttttgttttgttttgtttgcctttggcttg
tacctatttctcaaacttcttgatgttgatctcctgtggtcggtcttcaaagccaagaaa
tggcgcaccaatccagactggatccacatggacacaactctgtttgctggcctggtgaga
aaccttggggttctttttggattaggctttgcaagcagttctgaagtggttttttttttt
ttgagctgtcagggaaaggacagttataaactgagtttcaacctgctatgtatgatgact
tcattgaccctcctgtaactgtaaaattttgttaagatcccaacccatgctgaatatttg
ttttatgtgttatctttctgtcaaagtgcatccattccattcactgtggttgctgtgatt
tcttactgcatacatgtgcccagggaaaagaagattaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system