KEGG   Monodelphis domestica (opossum): 554233Help
Entry
554233            CDS       T01031                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    554233 (BDNF)
   04024 cAMP signaling pathway
    554233 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    554233 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    554233 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    554233 (BDNF)
   05034 Alcoholism
    554233 (BDNF)
Cytokines [BR:mdo04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    554233 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 272 aa AA seqDB search
MFHQNPGVESITTFIIMPEFHQVRRVMTILFLTMVISYFGCMKAAPMKETSVRGQGSLAY
PNMRTHGTLESLNGPKAGSRGLTSLADTFEHVIEELLDEDQNVQPREENKDADLYTSRVM
LSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKT
AVDMSGGTVTVLEKVPVPKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYV
RALTMDNKKRVGWRFIRIDTSCVCTLTIKRGR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatcagaatccaggggtggaaagcatcacaacattcataatcatgcctgagttc
caccaggtgagaagagtgatgaccatccttttccttactatggttatttcatacttcggt
tgcatgaaggctgccccgatgaaagaaaccagtgtccgaggacaaggcagcttggcctac
ccgaatatgcggacccacggaactctggagagtctaaatgggcccaaggcaggttcaagg
ggactgacatcattggctgacacttttgaacatgtgatagaagagcttctggatgaggac
cagaacgttcagccgagggaagagaataaggatgccgacttatacacatctagggtcatg
ctcagcagtcaagtgcctttggaaccccccctgctctttctccttgaggaatacaaaaat
tacctggatgcggcaaacatgtccatgagggtccgtcgccattctgaccctgcccgtcga
ggggagctgagcgtgtgtgacagtattagcgagtgggtcacagcggcggataaaaagact
gcagtggacatgtcgggggggacggtcacagtccttgaaaaggtcccagtccccaaaggc
caactgaagcaatatttctacgagaccaagtgtaatcccatgggttatacaaaagaaggt
tgcagaggcatagacaaaaggcattggaactcccagtgtcgaactacccagtcttacgtg
cgagcgctcaccatggataataaaaagagagtcggttggaggttcatcagaatagacact
tcctgtgtatgtacactgactattaaaaggggaagatag

DBGET integrated database retrieval system