KEGG   Monodelphis domestica (opossum): 768082Help
Entry
768082            CDS       T01031                                 

Gene name
PLN, PLB, PLB1
Definition
phospholamban (EC:3.1.1.5 3.1.1.4)
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Vitamin digestion and absorption
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mdo00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:mdo00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mdo00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mdo00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:mdo00592]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:mdo04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1474 aa AA seqDB search
MRLQPSLLLLALLLLKVTTIQATLGNNSWEEQTWPEGLKNFPFPCRPEEIPFSPPSESVH
SLRISDIRVVGAIGNLETTPDAKMVLKRQKWIERNQMQTCMQVMTVLSDFIKKFSPSVLP
LLCPSREKVLPRMRNEDLGPQARELVQHMKKNQKLNFRNDWKLINVFFNAQSQCHPCSSS
QKEGNMTSSMQELIRLLDYLQKEVPKAFVNLVDISELGNSIQSNNQENGPRDINEVCECP
QEPSRLTTAVQRWYYQNSWEKLLTSGRYDTKDTFTVIYQSFLHEMEPSVFPIKQTSGSSL
KKLSTALAVSLWNGMIDPTGKKEEFFTTGQRIPVKCPTQKHPYLFTYRNNNKLSSTPEIK
RISETREGTEIRCPDMDPSNAVPTSVHHLRPADIKVIGALGDSLTAGNGAGSTPGNILDV
LTQYRGLSWSIGGNENISTVTTLANILREFNPSLIGFSTGTGNQNSAAAFLNQAVAGATS
ETLPSQARRLVDLMKENKRINFQDDWKIVTLFIGGNDLCDSCSDPPRYSSQNFTAHIGKA
LDILHAEVPRVFVNLVTVLSIVSLRELYQEESINCPRVILRSLCPCVLKFKDNSTELTTL
IELNKQYQEETHRLVDSGRYDTRDDFTVVLQPFLEQVPMPKTPEGLPDSSFFAPDCFHFH
SKAHARVARSLWNNMLEPVGEKKKEENLENIVDLICPSESQPYLRTYKNSNYTYPTATPT
SSPKPDYGSQLWCEDRAPSASFPTSVHALKPADIQVVAAVGDSLTAGNGIGSKPDDLPDV
ITQYRGLSYSAGGDASLESVTTLPNILREFNMNLTGFAVGVGSADDANAFLNQAVPGAKA
EGLKKQVQTLVQKMKSDPRINFQRDWKVITLLIGTTDLCDYCTDSNLYSATNFSAYLRDA
LDFLHREVPRALVNLVDFMNPIIFRQVFLGNQDKCPMTQACSLCNCLLTVREDSPELARM
KEVVKVYQTKIRELVESGRYDTREDFTIVLQPFLEEVKLAFQDGIPDVSFFAPDCIHPNQ
KFHSQLSRALWNNMLQPLGKKMDFLDLTADTTLSCPSLEEPFLRTYRNSNYTYPANPAIE
NWGSDFLCPEQGSSNSAPSSVHQLRPADIKVVAALGDSLTTAVGAGAKNNSNWSTAWRGL
SWSIGGDGTLETHTTLPNILKKFNPHLHGFSTGTQEEAAGLNVAVEGAIAQDMPSQARIL
VDRMKNSSEINLDQDWKLITIFVGSNDLCQYCENPEAHSVKNYVQSLQQALDIFYKELPR
AFINVVEIMELVGLRQIQGEKCAVTTQSICPCFGRSLDNSPELQEMKNINRHFQSGSSLI
TYHHQYMEREDFAVVVQPFFQSTVVPLDDKGKPDLSFFSVDCFHFSERGHAEMAIALWNN
MLEPVGQKQTYNNFTHSRTKVKCPTSENPYFFTMRNSGLLRKEASHKTPSVPFWAVLVAA
AASFIVGVVLVMLWRTKKCSRREERPISLVATVF
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atgagactgcagccaagcctgttgctcctggcgctgcttctgctaaaagtgaccacaatc
caggctaccctaggaaacaactcctgggaagaacagacatggccagagggcctgaagaat
tttccatttccctgcaggccagaggagataccattcagtcctccatcagagtcagttcat
tctctgagaatctctgatatcagagttgttggggccattgggaacctggaaacaactcca
gatgcaaagatggtcctgaagcggcaaaaatggattgagagaaaccaaatgcagacatgc
atgcaggtgatgacagttctttcagatttcatcaagaagttcagtccatctgtcttgcca
cttttgtgcccatccagggagaaggttttgccaagaatgagaaatgaagacctagggccc
caagccagagaactggtgcaacacatgaaaaagaaccagaaactgaattttcgtaatgac
tggaaactcatcaatgtcttcttcaatgcgcagagccagtgtcatccttgttcctccagc
caaaaggagggtaacatgaccagcagcatgcaagaactaataagactcttggactacttg
cagaaggaggtccccaaagcctttgtgaatctggtggatatctcagagcttgggaattca
attcaatcaaataatcaggagaatggacccagggacataaatgaagtgtgtgaatgccca
caggagccttcccgactgaccacagcagtacagagatggtactatcagaactcatgggaa
aaactactgacctcgggaagatacgacaccaaagatactttcacagtaatttatcaatct
ttcctccatgagatggagccttctgttttcccgatcaaacagacttctggttcctccctg
aaaaagttatcgactgcccttgctgtgagtctttggaatggcatgatagatccaacagga
aagaaggaagagtttttcaccacaggacaaagaattccagtgaaatgtcctacccagaaa
cacccctatctctttacctacagaaacaataataaactctcttccacaccagagatcaag
aggatatctgagacaagagaaggaacagaaatccgatgtcctgatatggatccctccaac
gcagtgcccacttcagttcatcatttgagacctgctgacatcaaggtgattggagccctg
ggagactcacttactgcaggtaatggagcaggatctacgcctggcaatatccttgatgtc
ctaactcaataccgaggtctctcttggagtattggagggaatgagaacatcagcaccgtc
accaccctagcaaacattctcagggaattcaacccatccctaattggcttctccactggc
actggaaaccagaacagtgcagcagccttcctgaaccaggctgtagcaggagccacatca
gagactctacctagccaggctagaagattggtagatctcatgaaagaaaacaaaaggata
aatttccaagatgactggaagatagtgaccctctttataggaggaaatgacctctgtgac
tcctgcagtgacccacctcggtattcttctcagaacttcacagcacacattgggaaggct
ctggacatcctccatgcagaggttcctcgggtctttgtgaacttagtaactgtgctatca
attgtcagcctgagggagctgtaccaggaggagagcatcaactgtccaagggtaatactc
aggtccctgtgcccttgtgtgctgaagtttaaggacaattccaccgagctcaccaccctc
attgagttgaacaaacaataccaggaggaaactcaccgactggttgacagtgggagatat
gataccagggatgatttcacagtggttttgcaaccatttttggagcaagttcctatgcca
aagaccccggagggactgcctgatagttctttctttgccccagattgtttccactttcac
agcaaggcccatgcacgtgtagccagatctctctggaacaacatgctggaaccagttgga
gagaagaaaaaagaagagaatcttgaaaacatagtcgatttaatttgccctagtgagagt
cagccctacctccgaacctataagaacagcaattatacctatccaacagcaactcctacc
agcagccccaaaccggattatgggagccagctgtggtgtgaagacagagctccttctgcc
tctttccccacgtcagtacatgctctgaaaccagcagacattcaagtcgttgcagctgtg
ggtgattctctgactgctggcaatggaattggctcaaaaccagatgatcttcctgatgtc
atcactcagtatcggggactgtcctatagtgcaggaggtgatgcctcattagaaagtgtg
accaccttgcctaatatcctccgagagtttaatatgaacctaacaggcttcgcagtgggt
gtggggagtgctgatgatgccaacgccttcctcaatcaggcagtaccaggagcaaaggct
gagggacttaaaaagcaagtccagaccctggtgcagaagatgaaaagtgacccgagaatt
aatttccaaagagactggaaggtgatcactctgctcattgggaccacagacctttgtgac
tattgcactgactcaaatttgtattcagccaccaacttttctgcttaccttcgagatgcc
ttggacttcttgcacagggaggtacccagagccttggtcaacctggtggacttcatgaac
cctatcatctttcgacaagtgttcctggggaaccaagacaaatgcccaatgacgcaggca
tgctctttatgtaactgcctcctgacagtcagagaagactctccagagctggccagaatg
aaggaagtcgtcaaagtctaccagaccaagatccgagagttggtggagtcaggccgctat
gacactagagaagacttcacaatagttctgcagccatttttagaagaagtcaagcttgcc
ttccaggatggaatcccagatgtctccttctttgccccagattgtatccacccaaatcag
aaattccactcccagctctccagagccctttggaacaatatgctccaaccattaggaaag
aagatggatttcctggatctgacagcagatacaactctatcctgcccaagtctggaggag
cccttcctgaggacctacagaaacagtaactacacatacccagccaatcctgctattgag
aactggggcagtgattttctgtgccctgagcaggggtcatccaacagtgctccctcatca
gtccaccaacttcggcctgctgacatcaaggtggttgcagctctgggagattcactaact
acagctgtaggagctggagccaaaaacaacagtaactggtccacagcttggaggggcttg
tcctggagtattggaggagatggaaccttagaaacgcataccactttgccaaatattttg
aagaaatttaacccccatctccatggattttctactggcacccaggaagaggcagctgga
ctaaatgtagcagtggaaggggccatagcacaggacatgccaagccaagcccgtatccta
gtggacagaatgaaaaatagttcggaaatcaatctggatcaagactggaagctgatcaca
atctttgttggaagtaatgacctctgtcagtactgtgaaaatccggaggcccattcagtg
aaaaactatgtacagtccctccaacaagcactggacatcttctataaagagttgcctcga
gccttcatcaacgtggtagaaattatggagctggtgggtctgcgtcagattcaaggggaa
aaatgtgcagtgacaactcaatctatttgcccttgctttggacgttccctagataattct
cctgaattgcaagagatgaagaacattaatagacatttccagagtggtagctcattgatc
acctaccatcaccaatacatggagcgggaggacttcgccgtggtggtgcagccattcttc
caaagcactgtggttccattggatgataaaggaaagccagacctgagcttcttctctgtg
gattgttttcacttctctgagaggggacatgctgagatggccattgcactctggaacaac
atgttggaaccagtgggccagaagcagacttacaacaacttcacccacagccggaccaaa
gtcaaatgcccaacctctgagaacccctacttttttacgatgaggaatagtgggctgctc
agaaaggaagccagtcacaagactcccagtgtccccttctgggccgtgctggtggctgct
gctgccagcttcatagttggcgtggtgctggtgatgctgtggaggaccaagaaatgctct
cggagggaagaacgccctatcagccttgtggcaacagtcttttaa

DBGET integrated database retrieval system