KEGG   Monodelphis domestica (opossum): 768082Help
Entry
768082            CDS       T01031                                 

Gene name
PLN, PLB, PLB1
Definition
phospholamban (EC:3.1.1.5 3.1.1.4)
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    768082 (PLN)
   00565 Ether lipid metabolism
    768082 (PLN)
   00590 Arachidonic acid metabolism
    768082 (PLN)
   00591 Linoleic acid metabolism
    768082 (PLN)
   00592 alpha-Linolenic acid metabolism
    768082 (PLN)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    768082 (PLN)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     768082 (PLN)
    3.1.1.5  lysophospholipase
     768082 (PLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1474 aa AA seqDB search
MRLQPSLLLLALLLLKVTTIQATLGNNSWEEQTWPEGLKNFPFPCRPEEIPFSPPSESVH
SLRISDIRVVGAIGNLETTPDAKMVLKRQKWIERNQMQTCMQVMTVLSDFIKKFSPSVLP
LLCPSREKVLPRMRNEDLGPQARELVQHMKKNQKLNFRNDWKLINVFFNAQSQCHPCSSS
QKEGNMTSSMQELIRLLDYLQKEVPKAFVNLVDISELGNSIQSNNQENGPRDINEVCECP
QEPSRLTTAVQRWYYQNSWEKLLTSGRYDTKDTFTVIYQSFLHEMEPSVFPIKQTSGSSL
KKLSTALAVSLWNGMIDPTGKKEEFFTTGQRIPVKCPTQKHPYLFTYRNNNKLSSTPEIK
RISETREGTEIRCPDMDPSNAVPTSVHHLRPADIKVIGALGDSLTAGNGAGSTPGNILDV
LTQYRGLSWSIGGNENISTVTTLANILREFNPSLIGFSTGTGNQNSAAAFLNQAVAGATS
ETLPSQARRLVDLMKENKRINFQDDWKIVTLFIGGNDLCDSCSDPPRYSSQNFTAHIGKA
LDILHAEVPRVFVNLVTVLSIVSLRELYQEESINCPRVILRSLCPCVLKFKDNSTELTTL
IELNKQYQEETHRLVDSGRYDTRDDFTVVLQPFLEQVPMPKTPEGLPDSSFFAPDCFHFH
SKAHARVARSLWNNMLEPVGEKKKEENLENIVDLICPSESQPYLRTYKNSNYTYPTATPT
SSPKPDYGSQLWCEDRAPSASFPTSVHALKPADIQVVAAVGDSLTAGNGIGSKPDDLPDV
ITQYRGLSYSAGGDASLESVTTLPNILREFNMNLTGFAVGVGSADDANAFLNQAVPGAKA
EGLKKQVQTLVQKMKSDPRINFQRDWKVITLLIGTTDLCDYCTDSNLYSATNFSAYLRDA
LDFLHREVPRALVNLVDFMNPIIFRQVFLGNQDKCPMTQACSLCNCLLTVREDSPELARM
KEVVKVYQTKIRELVESGRYDTREDFTIVLQPFLEEVKLAFQDGIPDVSFFAPDCIHPNQ
KFHSQLSRALWNNMLQPLGKKMDFLDLTADTTLSCPSLEEPFLRTYRNSNYTYPANPAIE
NWGSDFLCPEQGSSNSAPSSVHQLRPADIKVVAALGDSLTTAVGAGAKNNSNWSTAWRGL
SWSIGGDGTLETHTTLPNILKKFNPHLHGFSTGTQEEAAGLNVAVEGAIAQDMPSQARIL
VDRMKNSSEINLDQDWKLITIFVGSNDLCQYCENPEAHSVKNYVQSLQQALDIFYKELPR
AFINVVEIMELVGLRQIQGEKCAVTTQSICPCFGRSLDNSPELQEMKNINRHFQSGSSLI
TYHHQYMEREDFAVVVQPFFQSTVVPLDDKGKPDLSFFSVDCFHFSERGHAEMAIALWNN
MLEPVGQKQTYNNFTHSRTKVKCPTSENPYFFTMRNSGLLRKEASHKTPSVPFWAVLVAA
AASFIVGVVLVMLWRTKKCSRREERPISLVATVF
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atgagactgcagccaagcctgttgctcctggcgctgcttctgctaaaagtgaccacaatc
caggctaccctaggaaacaactcctgggaagaacagacatggccagagggcctgaagaat
tttccatttccctgcaggccagaggagataccattcagtcctccatcagagtcagttcat
tctctgagaatctctgatatcagagttgttggggccattgggaacctggaaacaactcca
gatgcaaagatggtcctgaagcggcaaaaatggattgagagaaaccaaatgcagacatgc
atgcaggtgatgacagttctttcagatttcatcaagaagttcagtccatctgtcttgcca
cttttgtgcccatccagggagaaggttttgccaagaatgagaaatgaagacctagggccc
caagccagagaactggtgcaacacatgaaaaagaaccagaaactgaattttcgtaatgac
tggaaactcatcaatgtcttcttcaatgcgcagagccagtgtcatccttgttcctccagc
caaaaggagggtaacatgaccagcagcatgcaagaactaataagactcttggactacttg
cagaaggaggtccccaaagcctttgtgaatctggtggatatctcagagcttgggaattca
attcaatcaaataatcaggagaatggacccagggacataaatgaagtgtgtgaatgccca
caggagccttcccgactgaccacagcagtacagagatggtactatcagaactcatgggaa
aaactactgacctcgggaagatacgacaccaaagatactttcacagtaatttatcaatct
ttcctccatgagatggagccttctgttttcccgatcaaacagacttctggttcctccctg
aaaaagttatcgactgcccttgctgtgagtctttggaatggcatgatagatccaacagga
aagaaggaagagtttttcaccacaggacaaagaattccagtgaaatgtcctacccagaaa
cacccctatctctttacctacagaaacaataataaactctcttccacaccagagatcaag
aggatatctgagacaagagaaggaacagaaatccgatgtcctgatatggatccctccaac
gcagtgcccacttcagttcatcatttgagacctgctgacatcaaggtgattggagccctg
ggagactcacttactgcaggtaatggagcaggatctacgcctggcaatatccttgatgtc
ctaactcaataccgaggtctctcttggagtattggagggaatgagaacatcagcaccgtc
accaccctagcaaacattctcagggaattcaacccatccctaattggcttctccactggc
actggaaaccagaacagtgcagcagccttcctgaaccaggctgtagcaggagccacatca
gagactctacctagccaggctagaagattggtagatctcatgaaagaaaacaaaaggata
aatttccaagatgactggaagatagtgaccctctttataggaggaaatgacctctgtgac
tcctgcagtgacccacctcggtattcttctcagaacttcacagcacacattgggaaggct
ctggacatcctccatgcagaggttcctcgggtctttgtgaacttagtaactgtgctatca
attgtcagcctgagggagctgtaccaggaggagagcatcaactgtccaagggtaatactc
aggtccctgtgcccttgtgtgctgaagtttaaggacaattccaccgagctcaccaccctc
attgagttgaacaaacaataccaggaggaaactcaccgactggttgacagtgggagatat
gataccagggatgatttcacagtggttttgcaaccatttttggagcaagttcctatgcca
aagaccccggagggactgcctgatagttctttctttgccccagattgtttccactttcac
agcaaggcccatgcacgtgtagccagatctctctggaacaacatgctggaaccagttgga
gagaagaaaaaagaagagaatcttgaaaacatagtcgatttaatttgccctagtgagagt
cagccctacctccgaacctataagaacagcaattatacctatccaacagcaactcctacc
agcagccccaaaccggattatgggagccagctgtggtgtgaagacagagctccttctgcc
tctttccccacgtcagtacatgctctgaaaccagcagacattcaagtcgttgcagctgtg
ggtgattctctgactgctggcaatggaattggctcaaaaccagatgatcttcctgatgtc
atcactcagtatcggggactgtcctatagtgcaggaggtgatgcctcattagaaagtgtg
accaccttgcctaatatcctccgagagtttaatatgaacctaacaggcttcgcagtgggt
gtggggagtgctgatgatgccaacgccttcctcaatcaggcagtaccaggagcaaaggct
gagggacttaaaaagcaagtccagaccctggtgcagaagatgaaaagtgacccgagaatt
aatttccaaagagactggaaggtgatcactctgctcattgggaccacagacctttgtgac
tattgcactgactcaaatttgtattcagccaccaacttttctgcttaccttcgagatgcc
ttggacttcttgcacagggaggtacccagagccttggtcaacctggtggacttcatgaac
cctatcatctttcgacaagtgttcctggggaaccaagacaaatgcccaatgacgcaggca
tgctctttatgtaactgcctcctgacagtcagagaagactctccagagctggccagaatg
aaggaagtcgtcaaagtctaccagaccaagatccgagagttggtggagtcaggccgctat
gacactagagaagacttcacaatagttctgcagccatttttagaagaagtcaagcttgcc
ttccaggatggaatcccagatgtctccttctttgccccagattgtatccacccaaatcag
aaattccactcccagctctccagagccctttggaacaatatgctccaaccattaggaaag
aagatggatttcctggatctgacagcagatacaactctatcctgcccaagtctggaggag
cccttcctgaggacctacagaaacagtaactacacatacccagccaatcctgctattgag
aactggggcagtgattttctgtgccctgagcaggggtcatccaacagtgctccctcatca
gtccaccaacttcggcctgctgacatcaaggtggttgcagctctgggagattcactaact
acagctgtaggagctggagccaaaaacaacagtaactggtccacagcttggaggggcttg
tcctggagtattggaggagatggaaccttagaaacgcataccactttgccaaatattttg
aagaaatttaacccccatctccatggattttctactggcacccaggaagaggcagctgga
ctaaatgtagcagtggaaggggccatagcacaggacatgccaagccaagcccgtatccta
gtggacagaatgaaaaatagttcggaaatcaatctggatcaagactggaagctgatcaca
atctttgttggaagtaatgacctctgtcagtactgtgaaaatccggaggcccattcagtg
aaaaactatgtacagtccctccaacaagcactggacatcttctataaagagttgcctcga
gccttcatcaacgtggtagaaattatggagctggtgggtctgcgtcagattcaaggggaa
aaatgtgcagtgacaactcaatctatttgcccttgctttggacgttccctagataattct
cctgaattgcaagagatgaagaacattaatagacatttccagagtggtagctcattgatc
acctaccatcaccaatacatggagcgggaggacttcgccgtggtggtgcagccattcttc
caaagcactgtggttccattggatgataaaggaaagccagacctgagcttcttctctgtg
gattgttttcacttctctgagaggggacatgctgagatggccattgcactctggaacaac
atgttggaaccagtgggccagaagcagacttacaacaacttcacccacagccggaccaaa
gtcaaatgcccaacctctgagaacccctacttttttacgatgaggaatagtgggctgctc
agaaaggaagccagtcacaagactcccagtgtccccttctgggccgtgctggtggctgct
gctgccagcttcatagttggcgtggtgctggtgatgctgtggaggaccaagaaatgctct
cggagggaagaacgccctatcagccttgtggcaacagtcttttaa

DBGET integrated database retrieval system