KEGG   Methylobacterium extorquens AM1: Mex_1p0008Help
Entry
Mex_1p0008        CDS       T00921                                 

Gene name
recD
Definition
(GenBank) Helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mea00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mex_1p0008 (recD)
Enzymes [BR:mea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mex_1p0008 (recD)
DNA repair and recombination proteins [BR:mea03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mex_1p0008 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 Helicase_RecD HHH_2 AAA_16 AAA_29 HHH_3 PIF1 NTPase_1 TrwB_AAD_bind AAA_28 T2SSE IstB_IS21 ArgK AAA_22 CbiA AAA UvrD_C HHH DUF853 RsgA_GTPase AAA_24 AAA_23
Motif
Other DBs
NCBI-ProteinID: ACS37981
UniProt: C5AP49
Position
9124..11325
Genome map
AA seq 733 aa AA seqDB search
MNTPLRSSAIDGAASLDMLAGSVERVTFHSAETGFCVLKIHARGRRDLVPVVGHAPAIAA
GEWLTASGRWVTDREHGLQFRADTLQVTPPTGIEGIERYLASGQMRGIGPMMAKRIVARF
GEAVFEIIEAEPARLTEVEGIGRKRAARIVKGWAEQKAVREIMIFLHAHGVGTARATRIF
RTYGGDSLKVMAEDPYRLARDIRGIGFRTADAIALRLGLARDAPQRLAAGVSYALQTAMD
EGHCGLPVERLVRLAAELLDVAPDLVRLAAALVLREGREVVADTLRGEPCLFLKGLHGAE
RVIAMRLAERAAGPPPWAAIDFALARPWVEAKTGKTLSASQAEAVGLVLRSKLCVLTGGP
GVGKTSTLDAILRILTAKGVRVLLAAPTGRAAKRMAEQTGLEARTLHRLLEIDPRNGGFQ
RNEDNPLDCDLLVIDETSMVDVPLMHALLKAVPERAGLILVGDVDQLPSVGPGQVLADVI
ASGTVPVARLTEIFRQAAQSRIVVNAHSINTGRMPAAPAKGEDSDFYLIDIEDADEGVET
LIELVTRRIPRRFGLDPTRDIQVLTPMIRGSLGSRNLNNALQRVLNPSPSAEVERFGWRF
APGDRVMETRNDYDRDVFNGDLGTISAIDAEDEALVVDFDGRAVIYPFNELDTLVPAFAT
TIHKAQGSEYPAVVIPVVTQHRTMLARNLLYTGVTRGRRLVVLIGQRRALAMAVREGASR
RRWTKLREWLDAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcccctccgctcctcggccatcgatggcgccgcttccctcgacatgctcgcc
ggctcggtcgagcgggtgacgttccacagcgccgagaccggcttctgcgtcctcaagatc
catgcccgcggccggcgcgacctcgtgccggtggtgggtcacgccccggccatcgccgcg
ggcgagtggctgacggcttccgggcgatgggtcacggaccgtgagcacggcctccagttc
cgcgccgacacgcttcaggtgacaccgccgaccgggatcgagggcatcgagcgctacctc
gcctccgggcagatgcgcggcatcggcccgatgatggccaagcgcattgtcgcccgcttc
ggcgaggcggtattcgagatcatcgaggccgagcccgcccgcctcaccgaggtcgagggc
atcggccgcaagcgcgccgcgcgcatcgtcaagggctgggccgagcagaaggccgtgcgg
gagatcatgattttcctgcacgcccacggcgtcggcaccgcgcgggcgacccggatcttc
cgcacctatggcggggattccctgaaggtcatggccgaggatccctatcgcctcgcccgc
gacatccgcggcatcggcttccgcacggcggacgccatcgccttgcgcctcggcctcgcc
cgcgacgcgccgcagcggctcgctgccggtgtctcctacgccctccagacggcgatggat
gagggccattgcgggttgccggtcgagcggctggtgcgcctcgccgccgagcttctcgac
gtcgcgcccgatctcgtccggctcgccgccgcgctcgtcctgcgcgagggccgcgaggtc
gtcgcggatacgctgcgcggcgagccctgcctgttcctcaagggcctgcacggcgccgag
cgcgtcatcgcgatgcggctggccgagcgcgccgccggcccgccaccctgggccgcgatc
gacttcgctctggccaggccctgggtcgaggcgaagaccggaaagacgctgtccgcctcg
caggctgaggcggtcgggctggtgctccgttcgaagctctgcgttctcaccggcgggccc
ggcgtcggtaagaccagcaccctcgacgcgatcctgcgcatccttaccgccaagggcgtg
cgggtgctgctcgccgcccccaccggccgcgcggccaagcgcatggccgagcagacgggg
ctggaagcgcgcaccctccatcgcctgctggagatcgacccacgcaacggcggctttcag
cgcaacgaggacaacccgctcgattgcgatctcctcgtcatcgacgagacctcgatggtc
gacgtgccgctgatgcatgccctcctcaaggccgtgccggagcgggcgggcctgatcctc
gtcggcgatgtcgatcagcttccctcggtcgggcccggacaggtgcttgccgacgtgatt
gcctccggaaccgtgccggtggcgcgcctcaccgagatttttcgccaagcggcgcagagc
cggatcgttgtcaatgcccacagcatcaacactgggcggatgccggccgcgcccgccaag
ggcgaggacagcgacttctacctcatcgacatcgaggacgcggacgagggcgtggagacg
ctgatcgaactcgtcacccgccgcatcccccgccgtttcggcctcgatcccacccgcgac
atccaagtgttgacgccgatgatccgcggctcgctcggcagccgcaacctcaacaacgct
cttcagcgcgtgttgaatccgtcgccctcggcggaggtcgaacgcttcggctggcgcttt
gcgcccggcgaccgggtgatggagacccgcaacgactacgaccgcgacgtgttcaacggc
gacctcggcacgatcagcgccatcgatgcggaggacgaagcgctcgtggtcgatttcgac
gggcgcgcggtgatctacccgttcaatgaactcgacacgctggtgccggccttcgccacg
acgatccacaaggcgcagggctcggaatatccggccgtggtgatcccggtggtgacccag
caccgcacgatgctggcgcgcaacctgctctataccggcgtcacccgcgggcgccgcctc
gttgtgctgatcggccagcgccgtgcccttgcgatggcggtccgcgaaggcgcctcgcgg
cggcgctggaccaagctgcgggagtggctggacgccgcctga

DBGET integrated database retrieval system