KEGG   Methylobacterium extorquens AM1: Mex_1p0049Help
Entry
Mex_1p0049        CDS       T00921                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta protein
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mex_1p0049 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mex_1p0049 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mex_1p0049 (trpB)
Enzymes [BR:mea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mex_1p0049 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(53086..54327)
Genome map
AA seq 413 aa AA seqDB search
MTLNPAPNSFRTGPDERGRFGIFGGRFVAETLMPLILDLEKAYADAKADPSFKADMESYG
THYIGRPSPLYFAERLTEHLRGKAPAGQGAKIFFKREELNHTGSHKVNNVLGQILLARRM
GKPRIIAETGAGQHGVATATLCARFGLKCVVYMGAVDVERQAPNVFRMKMLGAEVIPVQS
GTRTLKDAMNEALRDWVTNVSDTFYCIGTVAGPHPYPAMVRDFQSVIGIETKQQMLEMEG
RLPDSLIACIGGGSNAMGLFHPFLDDRDVEIYGVEAAGHGVQSGLHAASLTGGRPGVLHG
NRTYLLMNEDGQIADAHSISAGLDYPGIGPEHAWLHEMGRVTYLSATDAETLEAFKLCSM
LEGIIPALEPAHALSKVMELAPTKPAEHLMVLNLSGRGDKDIPQVAQIFGQTL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaaccccgcccccaattccttccgcaccgggccggatgagcgcggtcgcttc
ggcattttcggcggccgcttcgtggccgagacgctcatgccgctgattctcgatctcgag
aaggcctatgccgacgccaaggccgatccgtcgttcaaggcggatatggaatcctacggc
acacactacatcggccggccgagcccgctctactttgccgagcgcctgaccgagcatctg
cgcgggaaagctccggcggggcagggggcgaagatcttcttcaagcgcgaggagctgaat
cacaccggctcgcacaaggtgaacaacgtcctcggccagatcctgctcgcccgccgcatg
ggcaagccgcggatcatcgccgagaccggcgcaggccagcacggtgtcgcaacggcgacg
ctgtgcgcccgcttcggcctgaaatgcgtggtctacatgggcgccgtcgatgtcgagcgg
caggctccgaacgtgttccgcatgaagatgctcggcgccgaggtgatcccggtgcaatcc
ggcacgcgcacgctcaaggacgcgatgaacgaggccctgcgcgactgggtcaccaacgtc
tccgacaccttctactgcatcggcaccgtggccggcccccatccctatccggcaatggtg
cgcgatttccaatcggtgatcggcatcgagacgaaacagcagatgctggagatggagggc
cgcctgccggactcgctcatcgcctgcatcggcggcggctcgaacgccatgggcctgttc
caccccttcctcgatgaccgcgacgtcgagatttacggcgtcgaggcggccgggcacggc
gtgcagagcggcctccatgccgcctcgctcacgggcggccgcccgggcgtgctgcacggc
aaccggacctacctgctgatgaacgaggacggccagatcgccgacgcccactcgatctcg
gcgggcctcgattatcccgggatcggccccgagcacgcttggctgcacgagatgggccgg
gtcacctacctgtcggcgaccgatgcggagacgctggaggcgttcaagctctgctcgatg
ctggaaggcatcatcccggctctggagcccgcgcacgcgctgtcgaaggtgatggagctc
gcgccgaccaagccggcggagcacctgatggtgctgaacctctccggccgcggcgacaag
gacatcccgcaggtggcgcagatcttcggtcaaacgctctga

DBGET integrated database retrieval system