KEGG   Methylobacterium extorquens AM1: Mex_1p0207Help
Entry
Mex_1p0207        CDS       T00921                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mex_1p0207
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mex_1p0207
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mex_1p0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220466..221020
Genome map
AA seq 184 aa AA seqDB search
MTIRRRDCLAMLAVLAASRAHAAEAGPAGAFAFDKPEGGGLPLSAYAGKPILVVNTATAC
GYAPQFVGLQGLWTRFGGRGLTVIAVPSPDFGNQEPLDGAAIADAARKNHGVTFPVTDKT
HVRGPAAHPFYRWAAEQKPGQSPQWNFHKYLVGRNGTLRAAFATQVDPSDPRIVSAIVAE
LGQA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcgccgccgcgactgccttgcgatgctcgccgttctcgccgcgagccgcgcc
catgcggcggaagccgggccggcgggtgccttcgccttcgacaagccggagggcggcggc
cttccgctctcggcctatgccggcaagcccatcctcgtggtcaacaccgccacggcctgc
ggctacgctccgcaattcgtcggccttcaaggtctatggacccgcttcggcgggcggggc
ctgacggtgatcgcggtgccctcgcccgatttcggcaatcaagagccgctcgacggcgcc
gccatcgccgatgccgcgcgaaagaaccacggcgtcaccttcccggtcacggacaagacc
catgtgcgggggccggccgcccacccgttctaccgctgggcggccgagcagaagccgggg
cagagcccgcaatggaacttccacaaatatctcgtcggccgtaacggcaccctgcgcgcg
gccttcgcgacccaggtcgatccgagcgatccgcgcatcgtcagcgcgatcgtcgcggaa
ctggggcaggcctga

DBGET integrated database retrieval system