KEGG   Methylobacterium extorquens AM1: Mex_1p0244Help
Entry
Mex_1p0244        CDS       T00921                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
mea  Methylobacterium extorquens AM1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mex_1p0244
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mex_1p0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(264467..264988)
Genome map
AA seq 173 aa AA seqDB search
MTLVHVIERVTRAFRLPPLSQPVMLLALAFLVTACSDDSQERRRSLGDAPSFGDFMRVAD
AGRGARLFGQCAACHTVRMGAGDRNGPGLYDVVGKPVASRSRRFGYTGALRSAGGVWTPE
RLNAWLAAPAKFAPGTSMSFRGVPDPLDRADIVAYMQAQSVEAGGAEALSSRP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
ttgacgttggttcacgtgatcgaacgggtgacgcgcgccttccgtcttcccccactcagc
cagcccgtcatgctgctggcgctggccttcctcgtcacagcctgctcagatgatagccag
gagcgtcgccgttccttgggcgacgccccgagcttcggcgacttcatgcgggtggccgac
gcgggtcggggcgcccgcttgtttggccagtgcgccgcctgtcacacggtcaggatggga
gccggcgaccgaaacggacccggtctctacgacgtggttggcaagcccgttgcgagcagg
agccgacgcttcggctacacaggggccctccggtcggcgggcggcgtctggacgccggag
aggttgaacgcttggcttgccgctcctgcgaagttcgcgccgggcaccagtatgagtttt
cgcggagttcccgacccgctcgaccgggcggacatcgttgcatatatgcaagcgcagtcg
gttgaggccggaggtgctgaggcgctctcctcgcggccttga

DBGET integrated database retrieval system