KEGG   Methylobacterium extorquens AM1: Mex_1p0363Help
Entry
Mex_1p0363        CDS       T00921                                 

Gene name
rocF
Definition
arginase (arginine amidinase) (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mea01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mea00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
381687..382613
Genome map
AA seq 308 aa AA seqDB search
MPAPSTIDLIGAPIEIGTSEPGAVMGPAALRTAGLLRVLRDLGFTVRDQGDLDPDCTPGQ
RDLPAIRSWMTEISQAVETALDGGSLPLVAGGDHSLSLGSIDGALRHCGRTGQAVFVLWL
DAHADFNTLETSPSGNVHGMPLAALCGEPGFDDLFDGGERPLLDPRRIHLFGLRSIDAGE
RAIVTQRQVNVIDMRTIDEFGVVAPLRRILDRVAAANGYLHVSFDVDFLDPAIAPGVGTT
VPGGATFREAHLIMEMLCDSGLVGSLDVVELNPFLDERGRSARALVELVASLFGRRIIDR
PTEPPLEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaccgtccacgatcgacctcatcggcgcaccgatcgagatcggaacgagcgag
cccggagccgtgatggggccggcggccctgcgcaccgccggattgctgcgggtgcttcgg
gatctaggcttcacggtccgcgaccagggcgatctggaccccgactgcacgccgggccag
cgcgatctcccggcgatccgctcctggatgaccgagatctcgcaagcggtggaaacggcc
ctggacggcggaagcctgccgctcgtggcgggcggcgaccacagcctgtcgctcggctcg
atcgatggggcgctacgccattgcggccgcaccgggcaggcggtcttcgtgctgtggctc
gacgcccatgccgacttcaacaccctggagacatcgccctccggcaacgtccacggcatg
ccgctggccgccctgtgcggcgagcccggtttcgacgacctgttcgacggtggcgaacgc
ccactcctcgatccgcggcgcatccacctgttcggcctgcgctcgatcgatgccggcgag
cgggccatcgtcacgcagcggcaggtgaacgtcatcgatatgcggaccatcgacgagttc
ggcgtggtcgcgccgctgcgccgcatcctcgaccgggtcgcggccgcaaacggttacctg
catgtcagcttcgacgtggatttcctcgaccccgccatcgcgccgggcgtcggcacgacg
gtgccgggcggggcaacgttccgcgaagcgcatctcatcatggagatgctgtgcgattca
gggctggtcggctccctcgacgtggtggagttgaaccccttccttgacgagcgcgggcgc
agcgcccgggcgctcgtcgagctggtggcgagcctgttcggccgccgcatcatcgaccgg
ccgaccgagccgccgctggaggcgtga

DBGET integrated database retrieval system