KEGG   Methylobacterium extorquens AM1: Mex_1p0363Help
Entry
Mex_1p0363        CDS       T00921                                 

Gene name
rocF
Definition
arginase (arginine amidinase) (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mex_1p0363 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mex_1p0363 (rocF)
Enzymes [BR:mea01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Mex_1p0363 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
381687..382613
Genome map
AA seq 308 aa AA seqDB search
MPAPSTIDLIGAPIEIGTSEPGAVMGPAALRTAGLLRVLRDLGFTVRDQGDLDPDCTPGQ
RDLPAIRSWMTEISQAVETALDGGSLPLVAGGDHSLSLGSIDGALRHCGRTGQAVFVLWL
DAHADFNTLETSPSGNVHGMPLAALCGEPGFDDLFDGGERPLLDPRRIHLFGLRSIDAGE
RAIVTQRQVNVIDMRTIDEFGVVAPLRRILDRVAAANGYLHVSFDVDFLDPAIAPGVGTT
VPGGATFREAHLIMEMLCDSGLVGSLDVVELNPFLDERGRSARALVELVASLFGRRIIDR
PTEPPLEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaccgtccacgatcgacctcatcggcgcaccgatcgagatcggaacgagcgag
cccggagccgtgatggggccggcggccctgcgcaccgccggattgctgcgggtgcttcgg
gatctaggcttcacggtccgcgaccagggcgatctggaccccgactgcacgccgggccag
cgcgatctcccggcgatccgctcctggatgaccgagatctcgcaagcggtggaaacggcc
ctggacggcggaagcctgccgctcgtggcgggcggcgaccacagcctgtcgctcggctcg
atcgatggggcgctacgccattgcggccgcaccgggcaggcggtcttcgtgctgtggctc
gacgcccatgccgacttcaacaccctggagacatcgccctccggcaacgtccacggcatg
ccgctggccgccctgtgcggcgagcccggtttcgacgacctgttcgacggtggcgaacgc
ccactcctcgatccgcggcgcatccacctgttcggcctgcgctcgatcgatgccggcgag
cgggccatcgtcacgcagcggcaggtgaacgtcatcgatatgcggaccatcgacgagttc
ggcgtggtcgcgccgctgcgccgcatcctcgaccgggtcgcggccgcaaacggttacctg
catgtcagcttcgacgtggatttcctcgaccccgccatcgcgccgggcgtcggcacgacg
gtgccgggcggggcaacgttccgcgaagcgcatctcatcatggagatgctgtgcgattca
gggctggtcggctccctcgacgtggtggagttgaaccccttccttgacgagcgcgggcgc
agcgcccgggcgctcgtcgagctggtggcgagcctgttcggccgccgcatcatcgaccgg
ccgaccgagccgccgctggaggcgtga

DBGET integrated database retrieval system