KEGG   Methylobacterium extorquens AM1: Mex_1p0559Help
Entry
Mex_1p0559        CDS       T00921                                 

Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mex_1p0559
Enzymes [BR:mea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mex_1p0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
582940..583650
Genome map
AA seq 236 aa AA seqDB search
MRIWVSRPEPGASRTARRLAELGHAALVAPVLRIAPSDGPPPTGRFDGLILTSANAAAPL
AAAGLPEAPVFAVGTRTAERANRAGLRSVHCADGDAVSLARLVAAHVRPGGTLLHAAGED
RKAEPAASLTAAGYRVTTWTAYAALAETTLPAPVVQGLLGRDDAPLAAALHFSRRSAEIA
VHLSGKAGLSGAFRALAHYCLSPDVALGLVELGVAAHFVAARPSEEALLAGLAASD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctgggtgtcgcggcccgagccgggcgcgagccgcacggcacggcggctggcc
gagctcggccatgccgcgttggtggcgcctgtgctgcggatcgcgccgagcgacgggccg
ccgcccaccggccggttcgacgggctgatcctgacgagcgccaacgccgccgcgccgctc
gccgcagccggtcttcccgaggcaccggtcttcgccgtcggcacccgcaccgccgagcgg
gcgaaccgggcgggcctgcgctccgtgcactgcgccgacggagacgccgtcagcctggcc
cggctcgtcgcagcccatgtgcggccgggcggcactctcctccacgcggccggcgaggac
cgcaaggccgagcccgccgcgagcctcacggctgcgggctaccgcgtcacgacctggacc
gcctacgcggctctggccgagacgaccctgccggcgccggtggtgcaggggctgttgggc
cgggacgacgcgccgctcgccgcggccctgcatttttcgcgacgaagcgccgaaatcgcg
gtgcatttgtccggcaaagccggtctgagcggagcgtttcgggcgctggcgcattactgc
ctgtctccggacgtggccttgggactggtcgagctcggcgtcgcggcccattttgtagcg
gcgcgcccgagcgaggaagctctccttgccggtctcgcggcttcggactga

DBGET integrated database retrieval system