KEGG   Methylobacterium extorquens AM1: Mex_1p0695Help
Entry
Mex_1p0695        CDS       T00921                                 

Gene name
cycA
Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
mea  Methylobacterium extorquens AM1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mea00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mea02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
725101..725463
Genome map
AA seq 120 aa AA seqDB search
MRHLILGAALALLLPVAAHAEGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEG
ADGYAFSDALKKSGLTWDEANLKEWLADPKKKVPGTKMVFPGIKDPKKVDDIIAYLKTKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcctcggcgccgccctcgcgctgcttctgcctgtcgccgcccatgcc
gagggcgatgccgccgccggcgagaaggcgttcgcgccctgcaaggcctgccacaatttc
gagaagaacggcgtcggcccgaccctgaagggtgtcgtcggcgcgaaggccggtgagggt
gccgacggctacgccttctccgacgcgctgaagaagtccggcctcacctgggacgaagcc
aacctcaaggagtggcttgccgatccgaagaagaaggtgcccggcaccaagatggtcttc
cccggcatcaaggacccgaagaaggtcgacgacatcatcgcctacctcaagacgaagtcc
tga

DBGET integrated database retrieval system