KEGG   Methylobacterium extorquens AM1: Mex_1p0739Help
Entry
Mex_1p0739        CDS       T00921                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase ruvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mea00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mex_1p0739 (ruvA)
Enzymes [BR:mea01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mex_1p0739 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
770019..770645
Genome map
AA seq 208 aa AA seqDB search
MIGKLKGIVDSYGEDFVILDVNGVGYVVHCSARTLQRLPKPGEATDLAIETHVREDMIRL
YGFRVDAEREWFRLLQTVQGVGTRVALGVLSVLEPAQLATAIATGDKGAVARAPGVGPRL
AARLVAELKDKAPAFAPIDPALIALTGAVEDRTAPQPVADAISALVNLGYAQIQASAAIA
AALKGLGEEAGTVEAKTLIRLGLRELAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggaatcgtcgattcctacggagaggatttcgtcatcctcgac
gtgaacggcgtcggctacgtcgtccactgctccgcccgcaccctccagcggctgccgaaa
cccggcgaggcgacggatctggccatcgagacgcatgtgcgcgaggacatgatccgcctc
tacggcttccgcgtcgatgccgagcgggagtggttccgcctgctccagacggtgcagggg
gtcggcacccgcgtggcgctcggcgtgctctcggtgctggagccggcacagctcgccacc
gccatcgccaccggcgacaagggcgccgtcgcccgcgcccccggcgtcggcccgcgcctc
gcggcccgcctcgtcgccgagttgaaggacaaggcgcccgccttcgcccccatcgacccg
gcgctcatcgccctgaccggcgccgtcgaggacaggaccgcaccgcagccggtcgcggac
gcgatctcggccctggtcaatctcggctacgcccagattcaggcctcggccgccatcgcc
gccgccttgaagggcctcggcgaggaggccgggacggtggaggccaagaccctgatccgg
ctcgggctacgggagctggcgcgatag

  All links  
No link information was found.   
DBGET integrated database retrieval system