KEGG   Methylobacterium extorquens AM1: Mex_1p1116Help
Entry
Mex_1p1116        CDS       T00921                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mex_1p1116 (gpmA)
   01230 Biosynthesis of amino acids
    Mex_1p1116 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mex_1p1116 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Mex_1p1116 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mex_1p1116 (gpmA)
Enzymes [BR:mea01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mex_1p1116 (gpmA)
Exosome [BR:mea04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mex_1p1116 (gpmA)
  Exosomal proteins of melanoma cells
   Mex_1p1116 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1165156..1165794)
Genome map
AA seq 212 aa AA seqDB search
MDSTTHTLVLVRHGQSEDNERELFSGLRDPALTARGVNEARAAGRRLKTLGYRFDHAFTS
RLQRAQHTLALILEELSQTDLPVHADAALNDRDYGALAGLNKTEARARFGVKQVRSWRKS
SDAVPPGGESLAMTAARLWPFFERAIAPRVRSGKCVLVVAHGNSLRSLLMRLDHVAPADI
EDVNIGTAEMLIYRSNADDQTLVRAAAIACSS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaccacacatactctcgtgctcgtgcggcacggccagagcgaggataatgag
cgggagctgttttcgggtttgcgagatcctgccctgaccgctcgcggcgtcaacgaagcg
cgtgccgccggccgcaggctgaagacgctcggatatcgcttcgaccacgcgttcacgagc
cggcttcagcgtgctcagcacacgctcgccctgatccttgaggaactgagccaaaccgac
ctacccgtgcatgcggacgcggccttgaatgatcgagactacggcgcgcttgccggtttg
aataagacggaggctcgtgcccggttcggcgtcaagcaggtccgctcctggcggaaatct
tccgacgcggtgccgcccggcggcgagagcttggccatgacggcagcgcgcctgtggccg
ttcttcgagcgtgccatcgcacctcgcgttcgaagcggcaaatgcgtgctcgtcgttgct
cacggaaactcgctacgatccctgctcatgcgactcgatcatgtcgcccccgcagacatc
gaagatgtcaacatcggcacagcggagatgctcatctaccgcagcaacgcagatgatcaa
acgctcgtccgggcagctgcgatcgcttgttcgagttag

DBGET integrated database retrieval system