KEGG   Methylobacterium extorquens AM1: Mex_1p1169Help
Entry
Mex_1p1169        CDS       T00921                                 

Definition
cellulase, endoglucanase (celC) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mex_1p1169
Enzymes [BR:mea01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mex_1p1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1223218..1224336
Genome map
AA seq 372 aa AA seqDB search
MPQPAPQPAPQQTEATTVPPATALPGPPRAETSARTDSGPLLANTLGDDAAWRAYRSRFI
TEQGRIVDTANGLISHSEGQGYGMLLAVAAGDRPTFERIWGWTRANLMVRSDELLAWRWA
PDHRPAVSDMNNATDGDILVAWALTEAAEAWGEPSYRTAARRIAVEFGRKTILFKDPHGP
VLLPAVSGFSARERADGPLINLSYWVFPAFQRLPIVAPEYDWASLIRSGVDFLRQSRFGP
SSLPTEWISAKDSLRPADGFPPLFSYNAVRVPLYLAWAGVGRPEDYAPFKTLWGGIERER
LPIVDTRDGQPVEWLSEPGYMAISAITACAADGTPFPEALRTVQDNQNYYPATLQLLSLI
AARMRYPSCVKS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgcctcagcccgcgccccagcccgcgccccagcagacggaggccaccacggtgcccccc
gccacggccctgccgggcccgccgcgcgccgagacgtcggcgcggaccgattccggaccg
ctgctcgccaacaccctgggcgacgacgcggcgtggcgtgcctaccggtcgcggttcatc
accgagcagggccggatcgtcgataccgccaacggcctgatcagccacagcgagggccag
ggctacggcatgctgctcgcggtcgcggccggcgaccgacccaccttcgagcggatctgg
ggctggacccgcgccaacctcatggtgcgctccgacgaattgctggcatggcgctgggcg
cccgaccaccgcccggcggtctccgacatgaataacgccaccgacggcgacatcctggtc
gcctgggcgctcaccgaggcagcagaggcctggggcgagccgtcctaccgcaccgccgcg
cgccgcatcgcggtcgagttcggccgcaagaccatcctgttcaaggacccgcacggaccc
gtcctgctgccggccgtctccggcttctcggcccgcgagcgcgccgacggcccgctcatc
aacctgtcctactgggtcttccccgccttccagcggctgccgatcgtcgccccggaatac
gattgggcctcactgatccgcagcggcgtcgatttcctgcgccagtcccgcttcgggccg
agcagcctgccgaccgagtggatctcggccaaggacagcttacgccccgccgacggcttc
ccgccgctattctcctacaacgcggtccgggtgccgctctatctcgcctgggccggcgtc
gggcggccggaggattacgcgccgttcaagacgctctggggcgggatcgagcgcgagcgc
ctgccgatcgtcgacacccgcgacgggcagccggtcgagtggctgagcgagccgggctat
atggcgatctccgcgatcaccgcctgcgccgcggacggaacaccctttccggaagcctta
aggacggtgcaggacaatcagaactactatcccgccaccctccaactcctctcgctgatc
gccgcccggatgcggtatccgtcatgcgtgaaatcctga

DBGET integrated database retrieval system