KEGG   Methylobacterium extorquens AM1: Mex_1p1419Help
Entry
Mex_1p1419        CDS       T00921                                 

Definition
(GenBank) putative CysQ protein (PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase)
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00920  Sulfur metabolism
mea01100  Metabolic pathways
mea01120  Microbial metabolism in diverse environments
mea01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mex_1p1419
Enzymes [BR:mea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Mex_1p1419
Transfer RNA biogenesis [BR:mea03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Mex_1p1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ACS39281
UniProt: C5AZE7
Position
complement(1478749..1479672)
Genome map
AA seq 307 aa AA seqDB search
MTAPAPILADPPASLTAPVPAAMRDAIAEQLAGIACEAGRILRGYHGSDCPHVIKPDGSP
ASLADTRSEELIVAALGRAFPGIPVIAEETSGTAQPAPLFFLVDPLDGTRDFLAGSEQYC
VNIGLVQGDRPIAAALAAPGLNRVWAAGTTAREAPIREGRPGAFRPVGVRAAPADGLVAL
VSRLHGDSDTDACLDRLPIRERRVTSSALKFCLIAAGEADLYVRCVPTMEWDTAAGDHVL
TMAGGRVVGPDGATITYGHHARFYRNGPFAALASAAYRDALTLPQQSALSYFDRRRAGAA
VEAAGQE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccgctcccattctggccgatccgccggcgtccctgacggctcccgttccg
gcggcgatgcgggacgccatcgcggagcagctggccggaatcgcctgcgaggccgggcgc
attctgcggggttatcacggcagcgactgcccgcacgtcatcaagcccgacggctcgccg
gccagcctcgccgacacccgctccgaagagctgatcgtcgcggcactgggacgagctttc
cccggcatcccggtgatcgccgaggagacttccggcaccgcgcagcccgcacccttgttc
ttcctcgtcgatccgctcgacggcacccgcgacttcctcgccggcagcgaacagtactgc
gtcaatatcggcctcgttcagggagaccgtccgatcgccgccgctttggcggcgccgggg
ctcaaccgggtctgggcggcgggcaccacggcccgcgaggcgccgatccgcgaggggcgg
ccgggcgcgttccggccggtgggcgtgcgcgcggcccccgccgacggtctcgtcgccctc
gtcagccgcctgcacggcgacagcgacaccgatgcctgcctggaccggctgccgatccgc
gagcggcgggtcacgtcctcggcgctcaagttctgcctgatcgcggcgggcgaggcggat
ctctacgtgcgctgcgtccccaccatggagtgggacacggcggccggcgaccacgtgctg
accatggccggcgggcgcgtcgtcgggccggacggcgccacgatcacctatggccatcat
gcccgcttctaccgcaacggccccttcgcggcgctcgcctcggcggcctatcgcgacgcc
ctcaccctgccgcagcagagcgccttgtcctatttcgaccggcgccgcgcgggggcggcg
gttgaggccgccgggcaggaatag

DBGET integrated database retrieval system