KEGG   Methylobacterium extorquens AM1: Mex_1p1424Help
Entry
Mex_1p1424        CDS       T00921                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mea02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mea02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484721..1485869
Genome map
AA seq 382 aa AA seqDB search
MSAFPAVAHAPAARSPIKVLVADDSAVVRGLVSRWLGEAGHEVVATAPNGRAAVDALARC
NPDVVLLDIEMPELDGIQALPLMLAKQPGIQVVMMSTLTQRNADVSLRCLALGAVDYIPK
PESNRGVTTSDGFRNDLIERIRVFGAARARRRPGLTAVESASSAAPAAPAVSRLSGTVTL
RPKPRTVVPPRALLIGSSTGGPRAVGEVLEKIGAATLRRLPVLIVQHMPPVFTAVFAEHL
GARIGLPAAEGKADERLQPGRIYVAPGGRHMRLAGSAAETIIRLDDGPPVNFCRPAVDVM
FLDAAALYGGATLSVILTGMGSDGTAGSRALVEAGGILLAQDEATSTVWGMPGSVAKAGL
CHAVLPLPEIGPALRNAIAERV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcattcccggccgtcgcacacgctccggcggcgcgcagcccgatcaaggtgctg
gtcgccgacgattcggctgtggtgcgcgggctcgtctcgcgctggctcggcgaggcgggc
cacgaggtggtcgccaccgcgcccaacggccgcgccgccgtggacgcgctggcccgctgc
aaccccgacgtggtgctcctcgacatcgagatgccggaactcgacggcatccaggccctg
cccctgatgctcgccaagcagccggggatccaggtcgtgatgatgtcgacgctgacccag
cgcaacgccgatgtctccctgcgctgccttgcgctcggcgcggtcgattacatccccaag
cccgagagcaaccgcggcgtcaccacctcggacggcttccgcaacgacctgatcgagcgc
atccgggtgttcggggccgcccgcgcccgtcgtcgaccggggctgaccgcggtcgaatcc
gcctcctccgcggcgcccgccgcaccggccgtctcgcgcctgtcgggcacggtgacgctg
cggccgaagccgcgcaccgtggtgccgccgcgcgccctgctgatcggctcctcgaccggc
ggcccgcgggcggtcggcgaggtgctggagaagatcggcgcggccacgctccgacgcctg
ccggtgctgatcgtgcagcacatgccgccggtcttcaccgctgtcttcgccgaacatctc
ggcgcccggatcgggctgccggcggccgagggcaaggccgacgagcggttgcagcccggc
cgcatctatgtcgccccgggcgggcgccacatgcggctcgcgggctccgcggccgagacc
atcatccgcctcgacgacgggccaccggtgaacttctgccgcccggcggtggacgtgatg
ttcctcgatgccgccgcgctctacggcggggcgacgctgagcgtcatcctcaccggcatg
ggctcggacggcacggcgggctcccgcgcgctggtcgaggccggcggcatcctcctcgct
caggacgaagccaccagcacggtctggggcatgcccggcagcgtcgccaaagcgggcctg
tgccacgccgtcctcccgctccccgagatcggaccggctctgcgcaacgcgatcgcggag
cgggtttga

DBGET integrated database retrieval system