KEGG   Methylobacterium extorquens AM1: Mex_1p1538Help
Entry
Mex_1p1538        CDS       T00921                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00020  Citrate cycle (TCA cycle)
mea00640  Propanoate metabolism
mea00660  C5-Branched dibasic acid metabolism
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
mea01130  Biosynthesis of antibiotics
mea01200  Carbon metabolism
Module
mea_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mea_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mex_1p1538 (sucC)
   00640 Propanoate metabolism
    Mex_1p1538 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Mex_1p1538 (sucC)
Enzymes [BR:mea01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mex_1p1538 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACS39400
UniProt: C5B050
Position
1606577..1607773
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLKEFGLPVSRGVPIFKPEEAAAAADELGGPVWVVKSQIHAGGRGKGTFK
GAPEGAKGGVRVTKSKDEVVQFAREMLGQTLVTVQTGEAGKQVNRLYIEEGAAIAAEFYL
SMLVDRETGRVAFVVSTEGGMDIEQVAHDTPEKIVTFSVDPATGIMPHHGRAVAKALGLS
GPQAKEAGALTEKLYAAFTAKDMSMLEINPLVLTGDGGLKCLDAKISFDSNALYRHPEIV
ALRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGEEPANFLDVG
GGASEEKVTAAFKIITADPQVKGILVNIFGGIMKCDVIARGVIAAVKAVGLEVPLVVRLE
GTNVEEGKEIIRNSGLNVIPADDLDDAAQKIVAAVKKG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaggcaaaggctgtcctgaaggaattcggcctgccggtctcc
cgcggcgtgccgatcttcaagccggaggaggccgctgcggcggccgacgaactcggcggc
ccggtctgggtggtgaaatcgcagatccatgcgggcggacgcggcaagggcaccttcaag
ggcgcgcccgagggcgccaagggcggtgtgcgcgtcaccaagtccaaggacgaggtggtg
cagttcgcccgcgagatgctcgggcagacgctcgtgaccgtgcagaccggcgaggccggc
aagcaggtcaaccgcctctacatcgaggaaggcgcggcgatcgccgccgagttctacctg
tcgatgctggtcgatcgcgagaccggccgggtcgccttcgtcgtctcgacggaaggcggc
atggatatcgagcaggtcgcccacgacacccctgagaagatcgtcaccttctcggttgat
ccggccaccggcatcatgccccatcacggccgcgcggtcgccaaggcgctcggcctctcc
gggccccaggccaaggaagcgggcgcgctcaccgagaagctctacgcggccttcacggcc
aaggacatgagcatgctggagatcaacccgctggtgctcaccggcgacggcggtctcaag
tgcctcgacgccaagatctccttcgactcgaacgccctctaccgccaccccgagatcgtc
gcgctgcgcgacgagaccgaggaggacgccaaggagatcgaggcctcgaaatacgacctc
gcctacatcgccctcgacggcaccatcggctgcatggtcaacggcgccggcctcgccatg
gcgaccctcgacatcatcaagctctacggcgaggagccggcgaacttcctcgatgtcggc
ggcggcgcctccgaggagaaggtcacggcggccttcaagatcatcaccgccgatccgcag
gtgaagggcatcctcgtcaacatcttcggcgggatcatgaagtgcgacgtgatcgcccgc
ggcgtgatcgcggcggtgaaagcggtcggcctcgaagtgccgctcgtcgtgcgcctggaa
ggcaccaacgtcgaggagggcaaggagatcatccggaactccggcctcaacgtgatcccc
gcggacgatctcgacgacgccgcgcagaagatcgtcgccgcggtgaagaagggttga

DBGET integrated database retrieval system