KEGG   Methylobacterium extorquens AM1: Mex_1p1541Help
Entry
Mex_1p1541        CDS       T00921                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mex_1p1541 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mex_1p1541 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Mex_1p1541 (sucB)
Enzymes [BR:mea01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mex_1p1541 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1611968..1613296
Genome map
AA seq 442 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL
VKDGETVEPGAVLGSIVEGGKGSGKSDAKPAPKSAEPAETKTQSREEKGESKPAKEDAPA
QESSASYGSHGDAPPTDGRPADDSGPAVAKLARESGIDPASLNGSGKDGRVTKGDMLAAI
DRNGQKAPAQEARSETKAPPPRAPSAPDDAAREERVRMTKLRQTIAKRLKSAQETAAMLT
TFNDVDMGAVMAMRSQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQDLVY
KNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKISGFGKKAREGKLSIDEMQGGTFTI
TNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRNGKIEARPMMYLALSYDHRIVDGKE
AVTFLVRVKEALEDPARLVLDL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgacatcctcgtccccacgctcggcgaatccgtcagtgaggccacgatcggc
cgctggttcaagaagcccggcgacacggtggccgccgacgagcccctcgtcgaactcgag
accgacaaggtcacgctcgaagtgaacgccccggccgcgggcgaactcggcgagatcctc
gtcaaggacggcgagacggtggagcccggcgcggtgctcggctcgatcgtcgagggcggc
aagggctcaggaaaatcggatgcgaagcccgctccgaagagcgccgagccggccgagacc
aagacgcagtcccgcgaggagaagggcgagagcaagcccgccaaggaagacgcgcccgcc
caggaatcctcggcctcctacggcagccacggcgacgcgccgcccacggacgggcgcccg
gccgacgacagcggcccggcggtggccaagctcgcccgcgaatccggcatcgacccggcg
agcctcaacggcagcggcaaggacggccgcgtgaccaagggcgacatgctcgccgcgatc
gacaggaacggccagaaggctccggctcaggaagcccggagcgagacgaaggccccgccg
ccgcgcgccccctccgcgccggacgacgccgcgcgcgaggagcgcgtgcggatgaccaag
ctgcgccagaccatcgccaagcgcctcaagagcgcccaggaaacggcggcgatgctgacc
acgttcaacgacgtggacatgggcgcggtgatggcgatgcgctcgcagtacaaggacatc
ttcgagaagaagcacggcacgaagctcggcttcatgggcttcttcaccaaggcggtgatc
ggtgccctcaaggacgtgccggcggtcaacgccgagatcgacgggcaggatctcgtctac
aagaactactaccacatcggcatcgcggtcggcaccgataagggcctcgtcgtgccggtg
gtgcgcgacgccgacgacctctcgatcgccggcatcgagaagaagatctcgggcttcggc
aagaaggcgcgcgaaggcaagctctccatcgacgagatgcagggcggtaccttcaccatc
accaacggcggcatctacggctcgctgatgtcgaccccgatcctcaacgcgccgcaatcg
ggcatcctcggcatgcaccgcatcgaggagcggccggtggtgcgcaatggcaagatcgag
gcgcggccgatgatgtatctggccctctcctacgatcaccgcatcgtcgacgggaaggag
gccgtgaccttcctcgttcgcgtcaaggaagccctggaggatccggcccgcctcgtgctg
gacctgtaa

DBGET integrated database retrieval system