KEGG   Methylobacterium extorquens AM1: Mex_1p1814Help
Entry
Mex_1p1814        CDS       T00921                                 

Definition
dihydroflavonol-4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mea  Methylobacterium extorquens AM1
Brite
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Mex_1p1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1890090..1891133
Genome map
AA seq 347 aa AA seqDB search
MNHASTMTEPTQSGPFPAGPVLITGASGFLGAALVDVFRAAGFRVRITVRASSPRTNLIW
PDVEIVEADMRDRAAVASAMRGQRYLVHAAADYRLWAPDMEEIVRTNRDGTRILMEEALK
AGVERIVYTSSVATIKPHDDGTPADETRPLTPETAIGAYKRSKVVAERVVDEMVARDGLP
AVIVNPSTPIGPRDVKPTPTGRIILDAAQGKIPAFVDTGLNLAHVDDVAAGHLLALRKGR
IGEHYILGGEDVMLAQMLADIAAIVGRKAPTTRLPYAVIYPIAFISEQIARVTGKAPLAT
IDGVRMSKYRMFFSDAKARAELGYSARPYRRGLEDAIAWFRQAGYMK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcacgcgagcacgatgacagagccgacccaaagcggcccgttcccagcggggccg
gtgttgatcaccggtgccagcggcttcctcggagccgccctggtggacgtcttccgcgcg
gccggtttccgcgtgcgcatcaccgtgcgtgcctcatcgccccgcaccaacctgatctgg
cccgatgtcgagatcgtcgaggccgacatgcgcgaccgggcggcggtggcgagcgccatg
cgcggccagcgctacctcgtccacgccgcggccgattaccggctctgggcgccggacatg
gaggagatcgtccgcaccaaccgcgacggcacgcgcatcctgatggaggaggcgctcaag
gccggcgtggagcggatcgtctacacatcgagcgttgcgaccatcaaaccgcacgacgac
ggcacccccgccgacgagacccggccgctgacgccggagaccgccatcggcgcctacaag
cgcagcaaggtcgtggccgagcgcgtggtcgacgagatggtggctcgtgacggcctaccc
gccgtcatcgtgaacccctcgaccccgatcggcccccgcgatgtgaagccgacgccgacc
ggccgcatcatcctcgacgcggcccagggcaagatcccggccttcgtcgataccggcctc
aacctcgcccatgtcgacgacgtggctgcgggccatttgctggccctgcgcaagggccgg
atcggcgagcactacatcctcggcggcgaggacgtgatgctggcgcaaatgctcgccgac
atcgccgccatcgtcggccgcaaggcgccgacgacgcggctgccttatgcggtgatctac
ccgatcgctttcatctccgagcagatcgcgcgggtgaccggcaaggcgccgctcgccacc
atcgacggcgtgcgcatgtcgaagtaccggatgttcttctccgacgccaaggcgcgggcg
gaactcggctattccgcgcggccctaccgccggggcctcgaggatgccatcgcgtggttc
cgtcaggcggggtacatgaaatga

DBGET integrated database retrieval system