KEGG   Methylobacterium extorquens AM1: Mex_1p2776Help
Entry
Mex_1p2776        CDS       T00921                                 

Gene name
mauG
Definition
methylamine utilization protein mauG precursor
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mea  Methylobacterium extorquens AM1
Brite
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mex_1p2776 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2900786..2901847
Genome map
AA seq 353 aa AA seqDB search
MRAILPIPVLIAWAMVVCGGAYAVTTCSGAATATADASQQDLAALKARFRRPESVPHPKA
NPLTPEKVALGKALFFDPRLSRSGSVSCATCHNPSLGWSDGLTRAVGFGMVPLPRRTPPV
LNLAWGTAFQWDGRADSLEAQARMPITAPDEMNMSMDLVVERLKAVPGYAPLFRNAFGSE
EPIGARHVTAALATFQRTLVSGEAPFDRWALGDESAIGADAKRGFALFTGKAGCAACHST
WRFTDDSFHDIGLKAGNDLGRGKFAPPSVTAMRYAFKTPSLRDLRMEGPYMHDGQLGSLE
AVLDHYIKGGEKRPSLSFEMKPFEMSERERRDLVAFLETLKAEPAAITLPQLP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgatcctgccgatccctgtactaatcgcctgggccatggtcgtctgcggcggc
gcctatgccgtgactacgtgctccggcgctgccacagcaaccgctgacgcatcgcagcag
gacttggccgcgctcaaggcgcgcttccgccggcccgaaagcgtgccgcacccgaaggcc
aatccgctgacaccggagaaggtggcgctcggcaaggctttgttcttcgatccgcggctc
tcacgctcgggaagcgtctcgtgcgcgacctgccacaatccgagcctcggctggagcgac
ggcctaacccgtgccgtgggtttcggcatggtcccgctgccgcgacgtaccccgccggtt
ctcaatctcgcctggggtaccgctttccaatgggatggccgggccgacagcctggaggcg
caggcgcgcatgccgatcaccgcgcccgacgaaatgaacatgtcgatggatctcgttgtc
gagcgcctgaaggcggtgccgggctacgcgccgctcttccgcaacgccttcggcagcgaa
gagccgattggcgcgcgccatgtgaccgcggcgctcgccaccttccagcggacgctcgtt
tcgggcgaggcgccgtttgaccgctgggcattgggcgacgaaagcgccataggtgccgat
gcgaagagaggttttgctctgttcaccggcaaggccggctgcgccgcctgccattccact
tggcgcttcaccgatgacagcttccacgacatcggcctgaaggccggcaacgatctgggc
cggggcaagttcgcgccaccgagcgtgacggcgatgcgctatgccttcaagacaccgtca
ctgcgcgacctgcgcatggagggtccgtacatgcacgacgggcagctcggcagcctggag
gcggtgctggatcactacatcaagggcggcgagaagcggccgagtctatcgttcgagatg
aagccgtttgagatgtccgaaagggagcggcgcgatctggtcgccttcctagaaacgttg
aaagcggaacccgccgccattactttaccacaactgccatag

DBGET integrated database retrieval system