KEGG   Methylobacterium extorquens AM1: Mex_1p2835Help
Entry
Mex_1p2835        CDS       T00921                                 

Definition
quinolinate synthetase A (nadA-like)
Orthology
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mea00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2954962..2956005
Genome map
AA seq 347 aa AA seqDB search
MSEAGSALREPAERAFPLPHIYERVSRHVPAIEWPALAPDVEAILRLKRERNAVVLAHNY
QAPEIFHTVADIVGDSLALAREAARVDADVIVLAGVHFMAETAKLLNPGKTVLMPDMAAG
CSLADSITAADVRALRAKYPGVPVVTYVNTSAAVKAESDVCCTSGNAADVVRALGVPRVL
MIPDEFLAQNVQKQVPEVELLTWAGHCEVHERFTPADIADVRESYPGITVIAHPECPPDV
VEASDFSGSTAMMMNYVTEKRPSQVVLVTECSMADNIAVANPDIEFIKPCNLCPHMKRIT
LRNIREALETMTHEITVEEGLAERARLAVERMLAVKPTQTVSPRQAA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggcaggatccgcccttcgcgagccggccgaacgggccttcccgctgccccac
atctacgagcgcgtcagccgtcatgtgcccgcgatcgagtggccggcgctggctcccgat
gtcgaagccatcctgcgcttgaaacgcgagcgcaacgcggtggttctggcgcacaattac
caagcgccggagatcttccacaccgtggcggacatcgtcggcgacagtctcgcgctggcg
cgtgaagcggcacgggtcgatgcggacgtcatcgtgctggccggtgtccacttcatggcc
gagaccgccaagctcctgaaccccggcaagaccgtgctgatgcccgacatggccgccggc
tgctcgctcgccgattcgatcactgcggccgacgtgcgcgccctgcgcgccaagtatccg
ggcgtgccggttgtgacctacgtcaacacctccgccgcggtgaaagccgaatcggacgtg
tgctgcacctccggcaatgccgccgacgtggtgcgcgccctcggggtgccgcgggttctg
atgatcccggacgagttcctggcccaaaacgtccagaagcaggtgcccgaggtcgagctg
ctgacctgggccggacattgcgaggtgcatgagcgcttcaccccggccgacatcgccgat
gtgcgcgaaagctatcccggcatcaccgtgatcgcccatccggaatgcccgccggacgtg
gtcgaggcctcggacttctccggctcgacggcgatgatgatgaactacgtcaccgagaag
cggccgtcccaggtcgtgctcgtgaccgagtgctcgatggccgacaacatcgcggtggcc
aaccccgacatcgagttcatcaagccctgcaacctctgcccgcacatgaagcggatcacc
ttgcgcaacatccgtgaggcgctggagacgatgacgcacgagatcaccgtcgaggaagga
ctggccgagcgggcccgcctcgccgtcgagcggatgcttgcggtgaagccgacccagacc
gtctcaccgcggcaggccgcctga

DBGET integrated database retrieval system