KEGG   Methylobacterium extorquens AM1: Mex_1p3016Help
Entry
Mex_1p3016        CDS       T00921                                 

Definition
oxidoreductase, molybdopterin-binding subunit (EC:1.17.1.4)
Orthology
K11177  
xanthine dehydrogenase YagR molybdenum-binding subunit [EC:1.17.1.4]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mex_1p3016
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Mex_1p3016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3150481..3152724
Genome map
AA seq 747 aa AA seqDB search
MPDIAYEQARHGSSIGQPLTRRDGLLKVTGQATYAADNRPEGLLHAVVAVSRIARGRVAH
LDVAAAKAHPGVVEVMTGANAPRLAQDPDAKDNPFMFRLDLLQNDRVRYAHQPIAVVIAE
TLEAATEGAELLAPRYEVDSPRIGLDAGDPEEPEGVGAGDKAIVSRGDVEAGLGQAERRV
EATYETPAQYHNALEPHAIVAQWDGDRLIVDTPSQGLAMAKMRLAGLFGLNPKNILVRSP
FLGGGFGSKGFLSGPQILGVMAAKLVGRPVKLVLRREQMFGPVGHRAETRQTLRLGTDAD
GSLTALDHHTLTATSRFDDFYEPASAISRYLYAAPAVSTRHSGVRVDTGTPLFMRAPGEA
SGSVALEGAIDEMAEACGLDPLEFRLRNYAEDEPISGRPFSSKALRECYAQGAARFGWDK
RAPAPRSMRDSAGRLVGYGMGTALFPALMMQAEARAEIRADGTGTVALGAHDMGQGAWTA
LAQIAADGLGIDLAQLDFQSGTSDLPNAGIAGGSAHTATAGTAIHSAAAAVLAQLADLAT
NDERSALYGAGNAGVYARGGRLIRRDDEGRSESFTEILNRAGRASISAQGQGAPDPAARE
AYAMHAHGAVFAEVSVDPDLGQIRVTRLVGAFAAGRIVNPRLVTSQYNGGMIWGVSFALH
ENAVVDPRSGRVMNANLGEYHVPVNADVPSIEAILVDEHDPHVNPLGIKGVGEIGITGTA
GAIANAVYHATGIRVRKTPITLDRLLG
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacatcgcctacgagcaggcccggcacgggtcgagcatcggccagccgctcacc
cgccgcgacggtctcctgaaggtcaccggacaggcgacctacgccgccgacaaccggccg
gagggcttgctccacgcggtggtggcggtgagccgcatcgcccgcggccgggtggcccat
ctcgacgtcgcggcggccaaggcccatcccggcgtggtcgaggtgatgacgggcgccaac
gcgccgcggctcgcccaggacccggacgcgaaggacaaccccttcatgttccggctcgat
ctgctgcagaacgaccgcgtccgctacgcgcaccagccgatcgccgtggtgatcgccgag
acgctggaggctgcgaccgagggtgccgagctgctggccccgcgctacgaggtggattcg
ccgcgcatcgggctcgatgccggggatccggaggagcccgagggcgtcggtgcgggcgac
aaggcgatcgtgtcgcgcggcgatgtcgaggccgggctgggacaggccgagcgccgggtc
gaggcgacctacgagacaccggcgcagtatcacaacgcgctcgaaccccacgccatcgtg
gcgcagtgggatggcgaccggctcatcgtcgacacgccgagccaggggctcgccatggcc
aagatgcggctcgccggcctgttcgggctcaacccgaagaacatcctcgtccgctctccc
tttctcggcggcggcttcggctcgaagggttttctctccgggccgcagatactcggcgtg
atggcggccaaactcgtcggacggccggtgaagctcgtgctgcgtcgggagcagatgttc
ggccctgtcggccaccgcgccgagacgcggcagacgctgcggctcggcaccgacgcagac
ggatcgctcaccgccctcgaccaccacacgctgacggcgacgagccggttcgacgacttc
tacgagccggccagcgccatctcccggtacctctacgccgcgcccgcggtctcgacgcgt
cattccggcgtgcgggtcgataccggcacgccgctcttcatgcgcgcgcccggcgaggct
tcgggcagcgtcgccctggagggcgcgatcgatgagatggcggaagcctgcggcctcgac
ccgctcgaatttcgcctaaggaactacgccgaggacgagccgatctccggcaggccgttt
tcctcgaaggccctgcgcgaatgctatgcgcaaggcgccgcccgcttcggctgggacaag
cgcgccccggcgccccgatcgatgcgcgattccgccgggcgcctcgtcggctacggcatg
ggcacggccctgttcccggccctgatgatgcaggcggaggcgcgggccgagattcgcgcc
gacggcaccggcacggtcgcgctcggcgcccacgacatggggcagggcgcctggaccgcg
ctggcgcagatcgccgccgacggcctcgggatcgaccttgcgcagctcgatttccagagc
ggcacgtcggacctgccgaatgccggcattgccggcggctcggcccacaccgccaccgcc
ggcacggcgatccattccgccgctgccgcggtgctggcgcaacttgccgacctcgcgacc
aacgatgagcgctcggccctctatggcgccggcaatgccggcgtctacgctcgcggcggc
aggctgatccgacgggacgacgagggacgcagcgagtcgttcaccgagatcctgaaccgg
gccggccgcgcctcgatctcggcgcaagggcagggcgcccccgatccggcggcgcgcgag
gcctacgcgatgcacgcccacggcgcggtcttcgccgaggtcagcgtcgatcccgatctt
ggccagatccgcgtcacccgcctcgtcggcgcgttcgccgccggccgaatcgtcaacccg
cgcctcgtcacgagccagtacaatggcggcatgatctggggcgtgtccttcgcgctccac
gaaaacgccgtggtcgatccccgttcgggccgggtgatgaatgccaatctcggcgagtac
catgtgcccgtgaacgcggacgtaccgtcgatcgaagcgatcctcgtcgacgagcacgat
ccgcacgtgaacccgctcggcatcaagggcgtcggtgagatcggaatcaccggcacggcg
ggcgccatcgccaacgcggtctatcacgccacagggatcagggtgcgcaagacgccgatc
acgctggaccgattgttggggtga

DBGET integrated database retrieval system