KEGG   Methylobacterium extorquens AM1: Mex_1p3078Help
Entry
Mex_1p3078        CDS       T00921                                 

Gene name
galM
Definition
galactose mutarotase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mex_1p3078 (galM)
   00052 Galactose metabolism
    Mex_1p3078 (galM)
Enzymes [BR:mea01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Mex_1p3078 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3218130..3219110)
Genome map
AA seq 326 aa AA seqDB search
MRDDLRVQVIDYGAIVTTIEVPDREGRRANVVLALDTVEGYETVSPHFGAIAGRYANRIA
KGRFTLDGPPFELPINEPPNSMHGGPEGFAKRLWQVAEADHTRVVLRRRSPDGEEGFPGN
LDVEVVYSLPEPGTLRIDYRAETDRPTVLNLTNHSYFNLAGEGTGDVMDHVVQIVADAYA
PTDATQIPTGIIAPVAGTPLDFREPTPLGARIRQGHEQVVIAGGYDHTFALGDPAGTLRP
AASCFCPASGRRLDVATTQPALQLYSGNNLDGSLVGPSGRTYRSGDGVCFETQGFPDAPN
HPNFPSTILRPGEVFTSISTYRFSVG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgacgatctgcgggttcaggtgatcgattacggcgcgatcgtcaccaccatcgaa
gtgccggaccgggagggccgccgcgccaacgtcgtcctcgccctcgatacggtggagggc
tacgagacggtgagcccgcatttcggggcgattgccggacgttacgccaaccgcatcgcc
aaggggcgcttcaccctcgacgggccccccttcgaactgccgatcaacgagccgcccaat
tccatgcatggcggccccgagggtttcgccaagcgcctctggcaggtggcggaggcggac
cacacaagggtcgtgctgaggcggcgcagccccgacggcgaggaaggctttccgggcaat
ctcgacgtggaggtcgtctacagcctgcccgagcccggaacgctgcgcatcgattaccgc
gccgagaccgaccggccgaccgtgctgaacctgaccaatcacagctacttcaacctcgcc
ggcgagggcacgggcgacgtgatggatcacgtcgtgcagatcgtcgccgacgcctacgcg
ccgacggacgcaacgcagatcccgaccggaatcatcgcgccggttgccggcacgcccctc
gatttccgcgagcccacgccgctcggtgcgcgcattcggcagggtcacgagcaggttgtg
atcgcgggcggctacgaccataccttcgctctgggagatcccgccggcacgctgcgcccg
gcagcctcctgcttctgcccggccagcggacggcgcctcgacgtcgcgacgacccagccg
gcgctgcaactctacagcggcaacaatctcgacggctcgctggtcggcccgtccggccgc
acctaccgctcgggcgacggcgtctgcttcgagacgcaggggtttcccgatgcgccgaac
cacccgaactttccgagcaccatcctgaggccgggcgaggtttttacctcgatcagcacc
taccggttctcggtcggctga

DBGET integrated database retrieval system