KEGG   Methylobacterium extorquens AM1: Mex_1p3234Help
Entry
Mex_1p3234        CDS       T00921                                 

Gene name
lspL
Definition
UDP-glucuronate 5'-epimerase (EC:5.1.3.12)
Orthology
K08679  
UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mex_1p3234 (lspL)
   00520 Amino sugar and nucleotide sugar metabolism
    Mex_1p3234 (lspL)
Enzymes [BR:mea01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     Mex_1p3234 (lspL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3373403..3374416
Genome map
AA seq 337 aa AA seqDB search
MHALVTGSAGFIGHALSRRLLAAGFGVTGFDGLSPYYDVGLKRARQADLAQSPRFEAVEA
RLETPGALLDVMARVKPDLVFHLAAQAGVRYSLIDPGAYVEANLVGFANLLEAVRAHPVK
HLLVASTSSAYGGNASVPFRETDRAVSPLTLYAASKLANEAMAHSYAHLFRVPTTAFRFF
TVYGPWGRPDMALFLFTRKILAGEPIEVFGEGAAERDFTFIDDLIDAIVALSERPPPMPS
EGGPVSAADTLSTVAPYRLVNIGGGRPVRLDAMIGALEAALGRKAERVLKPLPPGDVIRT
HASPDLLRDLVGRLPETPLETGIPAFVRWYLDYYGDQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatgctctcgtcacgggctcggccggcttcatcggccacgcgctgagccgccgtctg
ctggcggcgggcttcggcgtgacgggcttcgacggcctctcgccctattacgatgtcgga
ctgaagcgcgcccggcaggcggatctcgcccaatctccccgcttcgaggcggtggaggca
cggctcgaaacgcccggcgcgctcctcgacgtgatggcgcgggtcaagccggacctcgtc
ttccatctcgcggcgcaggcgggcgttcgctacagcctgatcgaccccggcgcctatgtc
gaggcgaacctcgtcggcttcgccaacctgctggaggcggtgcgcgcccaccccgtcaag
cacctgctcgtcgcctcgaccagttcggcctatggcggcaatgcgagcgtgccgttccgc
gagaccgaccgcgcggtctcgccgctcaccctctacgccgcctcgaagctcgccaacgag
gcgatggcgcattcctacgcccacctgttccgcgtgccgacgacggcgttccgcttcttc
acggtttacggaccgtgggggcggccggacatggccctgttcctgttcacccggaagatc
ctagcgggcgaaccgatcgaggtgtttggcgagggcgcggccgagcgcgatttcaccttc
atcgacgatctcatcgacgcgatcgtcgcgctgtcggagcgcccgccgccgatgccgtcc
gagggcggcccggtctcggccgccgacaccctgagcacggtcgcgccctatcgtctggtc
aatatcggcggcggccgcccggtccggctcgatgccatgatcggcgccctggaggcggcc
ctggggcgcaaggccgagcgcgtgctgaagccgctcccgcccggcgacgtgatccgaacc
catgcgagtcccgacctgctgcgcgacctcgtcggccgcttgcccgagacgccgctggag
actggcatccccgccttcgtgcggtggtatctcgactattacggggaccaatag

DBGET integrated database retrieval system