KEGG   Methylobacterium extorquens AM1: Mex_1p3265Help
Entry
Mex_1p3265        CDS       T00921                                 

Definition
(GenBank) putative Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00480  Glutathione metabolism
mea00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mex_1p3265
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mex_1p3265
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mex_1p3265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ACS41007
UniProt: C5AXD9
Position
complement(3396232..3396726)
Genome map
AA seq 164 aa AA seqDB search
MSNLYDHVPRDARGGPHPLSQYRGKVLLVVNTASKCGFTPQYQGLETLWRRHRARGFVVL
GLPCNQFGAQEPGDAAAIEQFCSLTYDVTFPVLAKVEVNGPGADPLYVDLKREKPGLFGT
QAIKWNFTKFLIGRDGQVIGRFSPSTKPEALDGAIERALAEPGE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctctacgatcacgtcccgcgcgacgcgcgcggcggaccgcatcccctgtcg
cagtatcgcggcaaggtgcttctggtggtcaacaccgcttcgaaatgcgggttcacgccg
caatatcagggcttggagaccctatggcggcgccatcgcgcccgcggcttcgtggtgctc
ggcctgccctgcaaccagttcggtgcacaggagccgggcgatgccgccgccatcgagcag
ttctgctcgctgacctacgacgtgacctttccggtcctcgccaaggtcgaggtcaacggt
ccgggcgccgacccgctctatgtcgatctcaagcgcgagaagcccggcctgttcggcacg
caggccatcaagtggaatttcacgaaattcctgatcggccgggacggccaggtgatcggc
cgcttctccccgtccacgaagcccgaggcactggacggtgcgatcgagcgggccctggcc
gagccgggcgagtag

DBGET integrated database retrieval system