KEGG   Methylobacterium extorquens AM1: Mex_1p3452Help
Entry
Mex_1p3452        CDS       T00921                                 

Definition
(GenBank) putative fatty acid oxidation complex subunit alpha (enoyl-CoA hydratase and epimerase and isomerase; 3-hydroxyacyl-CoA dehydrogenase) (fadJ-like; synonym yfcX)
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00071  Fatty acid degradation
mea00280  Valine, leucine and isoleucine degradation
mea00281  Geraniol degradation
mea00310  Lysine degradation
mea00362  Benzoate degradation
mea00380  Tryptophan metabolism
mea00410  beta-Alanine metabolism
mea00640  Propanoate metabolism
mea00650  Butanoate metabolism
mea00903  Limonene and pinene degradation
mea00930  Caprolactam degradation
mea01040  Biosynthesis of unsaturated fatty acids
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
mea01130  Biosynthesis of antibiotics
mea01200  Carbon metabolism
mea01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mex_1p3452
   00650 Butanoate metabolism
    Mex_1p3452
  Lipid metabolism
   00071 Fatty acid degradation
    Mex_1p3452
   01040 Biosynthesis of unsaturated fatty acids
    Mex_1p3452
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mex_1p3452
   00310 Lysine degradation
    Mex_1p3452
   00380 Tryptophan metabolism
    Mex_1p3452
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mex_1p3452
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mex_1p3452
   00281 Geraniol degradation
    Mex_1p3452
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mex_1p3452
   00930 Caprolactam degradation
    Mex_1p3452
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mex_1p3452
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mex_1p3452
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mex_1p3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 UDPG_MGDP_dh_N F420_oxidored NAD_Gly3P_dh_N Sacchrp_dh_NADP FAD_binding_3 ApbA 2-Hacid_dh_C NAD_binding_8 Pyr_redox_2 GIDA AlaDh_PNT_C Shikimate_DH TrkA_N Pyr_redox NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACS41189
UniProt: C5AY90
Position
complement(3589731..3591932)
Genome map
AA seq 733 aa AA seqDB search
MTATENFRFETDADGIALATWDMPGRSMNVITMEVMAELERIVDAVVADEAIKGCVIVSG
KNNFSAGADLTMLQGLGVEYERLKASEGEEVAMRHFFEESRRLSLVFRKLETCGKPFAAA
VHGLCLGGAFELALSCHHRVLADDDKTRVGLPEIKVGLFPGGGGTQRVSRLMQTGDALQM
LFKGEQIRALMAKNMGLAHAVAPAAEIVERAKAWIREGGSAVAPWDVPKFKAPSGKVYSP
AGMMIWPPANAIYRRETHDNYPAANAILASVYEGLQLPMDLGLRVESRYFAHILRTKEAQ
AMIRTLFISMGEINKGARRPKDVEATKVGKVGVIGAGFMGAGIAYVTAQAGMEVVLIDRD
QEAADAGKAHCHKLITGQINRGKAKTADRDALLARITATPDYGALSDCDLVIEAVFEDPK
VKAEVIAKVEAALPAHAIFASNTSTLPISGLAQTSKRPEQFVGIHFFSPVEKMLLVEIIR
GNQTGDRAVATALDYVRAIKKTGIVVNDSRGFFANRCVLAYIHEGHKMLTEGVPPAMIEN
VARMAGMPVGPLSLNDEVALDLGLKIMRATEAQLGEGAVDPDQKRLLVAMVETHGRLGRK
NKRGFYDYPEGGQKTLWPGLAEIQPNRLDPEGIDIDELKHRFLVVQALEAARTMQEGVVT
DPREADVGSILGFGFAPFTGGALSYIDFMGAKAFVALARQLEARHGPRFTPPDNLLAMAE
SGRRFYDALKQAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccgagaatttccgcttcgagaccgatgccgacggcatcgcgctcgcgacc
tgggacatgccgggccgttcgatgaacgtcatcaccatggaggtgatggcggagctggag
cggatcgtcgacgcggtcgtcgccgacgaggccatcaagggctgcgtcatcgtctcgggg
aagaacaacttctccgccggcgccgacctcaccatgctccagggcctcggggtcgagtac
gagcggctgaaggcgagtgagggcgaggaggtggccatgcgccacttcttcgaggaatcg
cggcgcctcagcctcgtgttccgcaagctcgagacctgcggcaagccgttcgcggcggcg
gtgcacggcctgtgcctcggcggcgccttcgagctggcgctgtcctgccatcaccgggtg
ctcgccgacgacgacaagacccgcgtcggcctgcccgagatcaaagtcggcctattcccc
ggcggtggcggcacgcagcgcgtgtcccgtctgatgcagaccggcgacgcgctgcagatg
ctgttcaagggcgagcagatccgcgcgctcatggccaagaacatggggctggcccacgcc
gtcgccccggccgcggagatcgtcgagcgggccaaggcctggatccgcgagggcggctcg
gcggtggcaccctgggacgtgccgaagttcaaggcgccgtccggaaaggtctactcgccc
gccggcatgatgatctggccgccggccaacgcgatctaccgccgcgagacccacgacaat
tatccggccgccaatgcgatcctggcctcggtctacgagggcctgcagctgccgatggat
ctcggcctccgggtcgagagccgctacttcgcccatatcctgcgcaccaaggaagcgcag
gcgatgatccgcaccctgttcatctccatgggtgagatcaacaagggcgcccgccgcccg
aaggacgtggaggcgaccaaggtcggcaaggtcggcgtgatcggcgccggcttcatgggc
gcgggcatcgcctacgtcacggcgcaggccgggatggaggtcgtgctgatcgaccgcgac
caggaggcggccgatgccggcaaggcgcattgccacaagctcatcaccggccagatcaac
cgcggaaaggcgaagaccgccgaccgcgacgcgctgctcgcccgcatcaccgccacgccc
gattacggcgccctgtccgattgcgacctcgtgatcgaggcggtgttcgaggacccgaag
gtcaaggccgaggtgatcgccaaggtcgaggcggcgctgccggcgcacgcgatcttcgcc
tccaacacctcgaccctgccgatctccggcctcgcccagacctcgaagcggcccgagcag
ttcgtcggcatccacttcttctcgccggtggagaagatgctgctcgtggagatcatccgc
ggcaaccagaccggcgaccgcgcggtggccaccgccctcgactacgtgcgcgcgatcaag
aagaccggcatcgtcgtcaacgattcccgcggcttcttcgccaaccgctgcgtgctcgcc
tacatccatgagggccacaagatgctcaccgagggcgtgcccccggcgatgatcgagaac
gtggcgcggatggccggcatgccggtcggcccgctctcgctcaacgacgaggtggcgctc
gatctcggcctcaagatcatgcgggcgaccgaggcgcagctcggcgagggcgccgtcgat
ccggaccagaagcggctcctcgtcgcgatggtcgagacgcatggccggctcgggcgcaag
aacaagcgcggcttctacgactaccccgagggcggccagaagacgctctggccggggctc
gccgagatccagccgaaccggctcgacccggagggcatcgacatcgacgagctgaagcac
cgtttcctcgtggtgcaggcgctggaggccgcccgcacgatgcaggagggcgtggtgacc
gatccgcgcgaggcggatgtcggctcgatcctcggcttcggcttcgcccccttcaccggc
ggcgcgctgtcctacatcgacttcatgggcgccaaggccttcgtggcgctggcccggcag
ttggaggctcggcacggtccccgcttcaccccgccggacaacctcctggcgatggccgaa
tccggaaggcgcttctacgacgcgctgaagcaggcggcgtaa

DBGET integrated database retrieval system