KEGG   Methylobacterium extorquens AM1: Mex_1p3527Help
Entry
Mex_1p3527        CDS       T00921                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mea00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mea00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3671053..3672000
Genome map
AA seq 315 aa AA seqDB search
MTAQTAPAFPHRHLLGIEGLSRPDIEALLERADAAVALSRQVEKKRTVLRGRTQINLFFE
PSTRTQSSFELAGKRLGADVMNMSVASSSVKKGETLIDTAATLNAMRPDIIVVRHHAAGA
VHLLARKVDCAVVNAGDGAHEHPTQALLDALTIRRNKGGIEGLQVAICGDVLHSRVARSN
IILLQALGARVRVIGPSTLLPTGIERFGVEVFTDMRAGLKGCDIVMMLRLQRERMNGSFV
PSVKEYFRYYGLDGDKLALAKPGALVMHPGPMNRGVEIASDIADGAQSLIREQVEMGVAV
RMAVLEALATHLPNG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcagaccgcacccgccttcccgcaccggcacctgctcggcatcgaaggcctg
agccggccggacatcgaagcgctcttggagcgcgccgacgccgccgtcgccctgtcgaga
caggtcgagaagaagcgcaccgtcctgcggggccgcacgcagatcaacctgttcttcgag
ccctcgacccgcacgcaatcctcgttcgaactcgcgggcaagcgcctcggcgccgacgtg
atgaacatgtcggtcgcctcgtcctcggtgaagaagggcgagacgctgatcgacacggcc
gcgacgctcaacgccatgcggcccgacatcatcgtggtgcgccaccacgcggcgggcgcg
gtgcatctgctcgcccgcaaggtcgattgcgccgtggtcaacgccggcgacggcgcccac
gagcacccgacccaggcgctgctcgacgcgctcaccatccgccgcaacaagggcggcatc
gaggggcttcaggtcgcgatctgcggcgacgtcctgcattcgcgggtggcgcgctccaac
atcatcctgcttcaggcgctcggcgcccgggtgcgggtgatcggtccctcgacgctgttg
cccaccggcatcgagcgcttcggcgtcgaggtgttcaccgacatgcgcgcggggctgaag
ggctgcgacatcgtgatgatgctgcgcctccagcgcgagcggatgaacggctccttcgtg
ccctcggtgaaggagtatttccgctattacggcctcgacggcgacaagctggcgctcgcc
aaacccggtgccctggtgatgcatccgggcccgatgaaccgcggcgtcgagatcgcctcc
gacatcgccgacggggcgcagtcgctgatccgcgagcaggtcgagatgggcgtcgccgtg
cgcatggccgtgctggaagcgctggcgacccatttgccgaacgggtga

DBGET integrated database retrieval system