KEGG   Methylobacterium extorquens AM1: Mex_1p3626Help
Entry
Mex_1p3626        CDS       T00921                                 

Definition
beta N-acetyl-glucosaminidase (nagZ-like) (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mea  Methylobacterium extorquens AM1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mex_1p3626
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Mex_1p3626
Enzymes [BR:mea01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mex_1p3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3766076..3767107
Genome map
AA seq 343 aa AA seqDB search
MTSASMTSASTPRAVILGCSGTALTPEEAAFFRDLRPWGFILFKRNIGTPDEVRALTTAL
RETVGRADAPILIDQEGGRVQRMGPPHWPKYPAGGRFNAFGNDAAAIARLGARLMAHDLA
SVGINVDCAPMLDVPVAGSDNIIGDRAYGDTPERVIELGRAVAEGLMAGGVLPVIKHIPG
HGRATCDSHLDLPVVEADRVSLGESDFRPFRALADLPLAMSAHVVFTALDPERPATLSER
VIREIVRGEIGFDGLLMTDDLSMHALQGPFRERAQAAYRAGIDVVLHCNGRMDEMRAIAE
AASDLAGEGARRAEAALARLTPPDAIDVDEARARFDAAFGAVA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagccagcatgacctccgccagcacgccccgcgccgtcatcctcggctgttcc
ggaacggcgctgacgcccgaagaggccgccttcttccgcgatctgcggccctggggcttc
attctgttcaagcgcaacatcggcacgccggacgaggtgcgcgccctgaccaccgccctg
cgcgagacggtcgggcgggcggatgcgccgatcctgatcgatcaggagggcgggcgggtg
cagcgcatgggcccgccgcactggccgaaatatcccgcgggcggccgcttcaacgccttc
ggcaacgacgccgcggcgatcgcccggctcggcgcccggctgatggcgcacgacctcgcg
tcggtcggcatcaacgtcgattgcgcgccgatgctcgatgtccccgtcgcgggctcggac
aacatcatcggcgaccgggcctacggcgacacgccggagcgggtgatcgaactcggccgc
gccgtcgccgaggggttgatggcgggtggcgtgctgccggtcatcaagcacattcccggt
cacggccgggcgacctgcgacagccatctcgacctgcccgtggtcgaggccgaccgcgtg
agtctgggcgagagcgactttcgcccgttccgggcgctggccgacctgccgctcgccatg
agcgcgcatgtggtgttcaccgccctcgaccccgagcggccggcgaccctgtcggagcgc
gtgatccgcgagatcgtgcgcggcgaaatcggcttcgacgggctcctgatgaccgacgac
ctgtcgatgcacgcgctccagggcccgttccgcgagcgggcgcaagccgcctaccgcgcc
ggcatcgatgtggttctccattgcaacggacgcatggacgagatgcgcgccatcgccgaa
gccgcgtccgatctggcgggggagggcgcacgccgggccgaggccgcgcttgcccgcctc
acgcctccggatgccatcgacgtggacgaggcgcgcgcgcgcttcgacgcggccttcggg
gcggtcgcataa

DBGET integrated database retrieval system