KEGG   Methylobacterium extorquens AM1: Mex_1p3803Help
Entry
Mex_1p3803        CDS       T00921                                 

Definition
Zn-containing alcohol dehydrogenase (adh) (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mex_1p3803
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mex_1p3803
  Lipid metabolism
   00071 Fatty acid degradation
    Mex_1p3803
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mex_1p3803
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mex_1p3803
   00626 Naphthalene degradation
    Mex_1p3803
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mex_1p3803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3929132..3930115)
Genome map
AA seq 327 aa AA seqDB search
MLAMVLREVGAPLVPEERPDPVPGPGEVRIRVEACAVCRTDLHLIDGELPQAVYPIVPGH
EVVGCVEALGLGVTEPRPGTRVGVPWLGHACGHCRYCGSGRENLCDAPGFTGCTRDGGFA
SHLVAEAAFTIPLDPALDAVATAPLLCAGLIGWRTLRMAGEAGTVGLYGFGAAAHIIAQV
CRWQGRRVFAFTRPGDREAQAFARTLGAEWAGDSDGQPPEPLDAALIFAPDGSLVPAALA
AVRKGGRVVCGGIHMSDIPAFPYDLLWGERAVLSVANLTREDARTFFEILPQAGIVTRTR
AFPLTQANAAIAAHRCGALQGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgatggtcctgcgcgaggtcggcgctcccctcgtcccggaggagcgtccggac
ccggttcctgggccgggcgaggtccgcatccgggttgaggcctgcgccgtctgccgtacc
gacctccacctcatagacggcgagcttccgcaggcggtctaccccatcgtgccgggccac
gaagtcgtcgggtgcgtcgaggccctcggtttaggcgtgaccgagcctcgaccgggtacc
cgcgtgggcgtgccctggctcgggcatgcctgcgggcattgccgctactgcgggagcggc
cgcgagaacctctgcgacgcgcccggcttcaccggctgcacgcgcgatggcggcttcgcg
agccacctcgtggccgaggccgccttcaccatcccgctcgacccggccctcgacgcggtc
gcgacggcgccgctcctttgcgctggtctgatcggctggcgcacgttgcgaatggccggg
gaggctgggaccgttggactctatggcttcggggcggctgcccacatcatcgcgcaggtc
tgccgctggcaggggcggcgcgtgttcgccttcactcggccaggcgaccgggaggcgcag
gccttcgcccgcacgctgggagcggagtgggctggggactccgacggccagccgcccgaa
ccgttggacgccgcgctcatcttcgccccagacgggagcctcgtgcccgccgctcttgca
gcggttcgcaagggcggccgcgtggtctgcggcggcatccacatgagcgacatcccggcc
ttcccctacgacctgctctggggcgagcgcgcggtgttatcggtggcgaacctgacccgc
gaggacgcgcggaccttcttcgagatcctgccgcaggccggcatcgtcacccgtacacgc
gccttccccctcactcaggccaacgcggccatcgcagcccaccgctgcggggctcttcaa
ggtgcagccgtcctcgtcccctga

DBGET integrated database retrieval system