KEGG   Methylobacterium extorquens AM1: Mex_1p3806Help
Entry
Mex_1p3806        CDS       T00921                                 

Gene name
xfp
Definition
D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase (EC:4.1.2.22 4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mex_1p3806 (xfp)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mex_1p3806 (xfp)
Enzymes [BR:mea01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Mex_1p3806 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3931130..3933676
Genome map
AA seq 848 aa AA seqDB search
MDATHGSREHHDGECRDDGDGLAFVPGPIGPDGLRQIDAYWRAANYLSVGQIYLMANPLL
REPLKPEHVKPRLLGHWGTTPGLNFIYAHLNRVIRERDLDMIAVWGPGHGAPGLVANAYL
EGTYAETYPDVAHDLDGMARLFRQFSFPGGIPSHASPELPGSIHEGGELGYSLAHAFGAA
LDNPGLTVACVVGDGEAETGPLAAAWHGNKFLDPRSDGTVLPILHLNGYKIANPTVLARI
PREELRSLLVGYGYEPTFVEGDEPAIMHQAMAAALDAAFDAITEIRIRARRGEAGRPRWP
LVVLRSPKGWTGPGSVDGKPVEGTWRSHQVPVAAVRENPEHRAILERWMRSYRPEELFTP
DGSLVPDLAALPPRGPRRLSANPHANAHRGAPLRLPELRRLAVTVPERGRTKAEATRALG
VYLRDVLTLNAEARNFRIMGPDETASNRLDAVFEVTSRAWQEEILPEDDHLGRDGRVMEV
LSEHLCEGWLEGYVLTGRHGLFATYEAFAHVIDSMVNQHAKWLKSARDLPWRRPVPSLNI
LLSSHVWRQDHNGFSHQDPGFIDFVANKRGDTARIYLPPDANCLLCVMDHCLRTYDRINV
VVAGKQPALQWLDMDAAARHCAAGVGIWDWASNEGEAEPDVVMACAGDVPTQETLAAVDW
LRRYVPELKVRVVNVVDLMTLPARETHPHGLDDPTFDSLFTRDRPVMFAYHGYPWLIHRM
TYKRTNHGNFHVHGFIEEGTTTTPFDMCVLNRLDRYHLAQAALRAVPGLGARGEHAEEAL
RDALAAHRVHVCRAGDDLPEVKDWSWPDRHGDEHPDRRRIEADIMQCDTAGAEEPRPART
ADDRACNA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaacacacggttcgagggagcaccacgacggcgaatgtcgagacgacggcgac
ggcttggcgttcgtacccgggccgatcgggcctgacggcctccggcagatcgacgcctac
tggcgcgccgcgaactacctgtcggtcggccagatctacttgatggccaacccgctcctg
cgcgagccgctcaagcccgagcatgtgaagccgcggctgctcgggcactggggtacgaca
ccgggcctgaacttcatctacgcgcacctcaatcgcgtcatccgcgagcgcgacctcgac
atgatcgcggtctgggggcccggccacggggcgccggggctcgtggccaacgcctacctg
gagggcacctacgccgagacctacccggacgtggcgcacgacctcgacgggatggcccgg
ctgttccggcagttctcgttccccggcggcatcccgagccatgcctcgcccgagttgccc
ggctcgatccacgagggcggagagctcggctattccctggcgcatgccttcggcgcagcc
ctcgacaatcccggtctgacggtcgcctgcgtggtcggcgacggcgaggccgaaaccggc
ccgctggcggccgcctggcacggaaacaagttcctcgacccgcggtccgacgggacggtc
ctgccgatcctgcatctcaacggttacaagatcgcaaacccgaccgtcctcgcccgcata
ccccgcgaggagttgcgcagcctgctcgtcggctacggctacgagccgaccttcgtggaa
ggcgacgagccggccatcatgcaccaagccatggcggcggcgcttgacgcagccttcgac
gccatcacagagatccggatacgggcgagacgcggcgaagctgggcgaccgcgttggcct
ttggtcgtgctgcgcagcccgaagggctggactgggccggggagcgtcgatggcaagccg
gtcgagggcacctggcgctcgcaccaggtgccggtcgccgccgtgcgcgagaacccggag
caccgtgcgatcctggagcgctggatgcgctcctaccggccggaggagttgtttacgccg
gacggctcgctcgtccccgacctcgccgcgctgccgccgcgggggccgcggcgcctgtca
gccaacccgcacgccaacgcgcacaggggcgcacccttgcggctcccggagctccggcgt
ctcgccgtcaccgtgccggagcgcggtcgtaccaaggccgaggccacgcgcgcgctcggg
gtctacctgcgggacgtcctgaccctgaacgcggaggctcgaaacttccgcatcatgggt
cccgacgagaccgcctcgaaccgcctcgacgccgtcttcgaggtgacgagccgcgcctgg
caggaagagatcctgcccgaggacgaccatctcgggcgcgacggtcgcgtcatggaggtg
ctgagcgagcacctctgcgagggctggctggagggctacgtgctgaccggacggcacggc
ctgttcgcgacctacgaggcctttgcgcatgtgatcgactcgatggtgaaccagcacgcc
aagtggctgaagtccgcgcgcgacctgccctggcgccggccggtgccctcgctcaacatc
ctgctctcgtcccatgtctggcgccaggaccacaacggcttcagccaccaggatccgggc
ttcatcgacttcgtggcgaacaagcgcggcgacacggcgcggatctacctgccgccggac
gcgaactgcctgctctgcgtcatggatcactgcctacgcacctacgaccgcatcaacgtc
gtggtggccggcaagcagcccgcgctgcaatggctcgacatggacgcggcggcccggcat
tgcgcggccggtgtcgggatctgggactgggcctcgaacgagggcgaggcggagccggac
gtggtgatggcctgcgcgggcgacgtgcccacccaggagacgctcgcggccgtggattgg
ctgcgccggtacgtcccggagctcaaggttcgggtcgtcaacgtcgtcgacctgatgacc
ctgccggcgcgcgagacgcacccgcacgggctcgatgacccgacattcgacagcctgttc
acacgcgaccggccggtgatgttcgcctatcacggctatccctggctcatccatcggatg
acctacaagcggacgaaccacggcaacttccacgtgcacggcttcatcgaggagggcaca
acgaccacgccgttcgacatgtgcgtgctgaaccgcctcgaccgctaccacctggctcag
gccgccctgcgggccgtcccggggctgggagcccggggcgagcacgccgaggaggcgctc
cgcgatgcgctggccgcccaccgcgtgcacgtctgccgggccggggatgatctaccggag
gtcaaggactggtcctggccggatcggcatggcgacgaacatccggaccgccgccgcatc
gaggccgacatcatgcagtgcgacacagccggtgccgaggagccgcgaccggccaggacc
gccgacgatcgggcgtgcaacgcctga

DBGET integrated database retrieval system