KEGG   Methylobacterium extorquens AM1: Mex_1p3860Help
Entry
Mex_1p3860        CDS       T00921                                 

Gene name
sdhD
Definition
succinate dehydrogenase delta subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mea  Methylobacterium extorquens AM1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mex_1p3860 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mex_1p3860 (sdhD)
   00650 Butanoate metabolism
    Mex_1p3860 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Mex_1p3860 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3970672..3971091
Genome map
AA seq 139 aa AA seqDB search
MSQVDNRQNTALSMRTPRARVKGLGASGHGAGHFWLQRLTGASNALLMLAFVVIIALMAG
RTYPQAVALVSHPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAV
AVAAACLYAILRVSLGGLA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggtcgacaaccgccagaacaccgcgctctccatgcgcacgccccgcgcccgg
gtgaagggcctcggcgcttcgggccacggcgccggccatttctggctgcagcgcctgacc
ggcgcctcgaacgcgctcctgatgctcgctttcgtcgtaatcatcgcgctgatggccggg
cggacttacccgcaggcggtcgcgctggtgtcgcacccgctcgttgcaatcatcctgatc
ctggccgtggtgtcggtgacgatccacatgcgtctgggcatgcagacggtcatcgaagac
tacgtccacagccacggcctcaagttcgcggcgctcatcgccaacaccttctacgcggtc
gcggtggccgccgcctgcctctacgcgatcctccgcgtgagcctgggcggcctcgcctga

DBGET integrated database retrieval system