KEGG   Methylobacterium extorquens AM1: Mex_1p4010Help
Entry
Mex_1p4010        CDS       T00921                                 

Definition
Phage-related lysozyme (Muramidase, Endolysin) (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mea  Methylobacterium extorquens AM1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4106407..4107018
Genome map
AA seq 203 aa AA seqDB search
MDLSPIGRAVLKSREGEVLTAYKDSVGILTIGVGITTASGLIKVTPGLTITAATSDALFT
EAVKAYAKPVSDLGVKLEQHQFDALVSLCFNIGQPAFTRSTVAKRLREGNVAGAAEAILM
WNKPAAIISRRQGEYDQFRTPYAIALPKARRGDRSPVKAPNFMAPVPAPAPAVLPKPVPP
VAEAPAQTGALGGWLSSLFRWAS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtcgcccatcgggcgcgcggttttgaagtcgcgcgaaggcgaggtgctgacc
gcctacaaggacagcgtgggtatcctcacgatcggcgtcgggattacgacggcttccggg
ctgatcaaggtgacgccggggctgacgatcacggcggccaccagcgacgcgctcttcacc
gaggccgtgaaggcatatgccaagccggtgtcggatctcggcgtgaagctcgaacagcac
cagttcgacgcactcgtgtcgctctgcttcaacatcggccagccagcgttcacgcgctcc
accgtggccaagcggctgcgtgagggcaacgttgccggcgcggctgaggcgatcctgatg
tggaacaagcccgcggcgatcatctctcgccgccagggcgagtacgatcagtttcgcacg
ccctatgcgatcgccctgccgaaggcccggcgcggagaccggtcgcccgtgaaggcgccg
aacttcatggcgcccgtacctgctccggcgcccgccgtgcttccgaagcccgtcccgcct
gttgctgaggcgcccgctcagaccggcgccctcggcggctggctgtcctcgctgttccgg
tgggcttcgtag

DBGET integrated database retrieval system