KEGG   Methylobacterium extorquens AM1: Mex_1p4303Help
Entry
Mex_1p4303        CDS       T00921                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mex_1p4303
Enzymes [BR:mea01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mex_1p4303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4395594..4396631)
Genome map
AA seq 345 aa AA seqDB search
MADESESAGARAERLARFQPASGMLTPRFSGLASFMRLPVLDPVEAVGDGAGEGAGEGTG
LIEIGLIGIPFDGTTTNRPGARLGPRAVREASTGTRALNHATGVAPYALAACADLGDVPV
NPVDAAETARRIEAFYRPLAEAGIVPLTVGGDHFITYPVLRALGAARPLGLIHIDAHSDT
DDSQYGGARLTHGTPFRRAVEDGVLDPRRCIQIGIRGSMDAADDRDWALAQGMRILTMEE
VCARGLPEVAAEARAVTGDGPTYLSFDIDALDPAFAPGTGTPEIGGFTTREALHLLRALR
GLDLVGADVVEVAPPLDSAGITALAGAGIAFEILCLLAERVAARH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgagagcgaatcggcgggcgcgcgggcggaacggctggcgcggttccagccg
gcctcggggatgctgacaccgcgcttctccggccttgcgagcttcatgcggctgccggtg
ctcgatcccgtcgaggcggtgggagacggggccggcgaaggggccggcgaagggactgga
ctgatcgagatcggcctgatcggcatccccttcgacggcaccaccaccaaccgccccggt
gcccggctcgggccgcgggccgtgcgcgaggcctccaccggcacgcgggcgctcaaccac
gccacgggggtggcgccctacgccctggcggcctgcgccgatctcggcgacgtgccggtc
aacccggtggacgccgccgagaccgcccggcggatcgaggcgttctaccggccgctcgcc
gaggccgggatcgtgccgctcacggtcggcggcgaccatttcatcacctatccggtgctg
cgggcgctcggggccgcccggccgctcgggctgatccatatcgacgcccacagcgacacc
gacgactcccagtatggcggggcgcggctcacccacggcacgccgttccggcgcgcggtc
gaggacggggtgctcgacccgcggcgctgcatccagatcggcatccgcggcagcatggat
gcggccgacgatcgcgactgggccctggcgcagggcatgcgcatccttacgatggaggag
gtctgcgcccgcggcctgccggaggtggccgcggaagcccgcgccgtgaccggcgacggc
ccgacctatctcagcttcgacatcgacgcccttgaccccgccttcgcccccggcaccggc
acgccggagatcggcggcttcaccacccgcgaggcgctgcacctgctgcgggccctgcgc
ggcctcgatctcgtcggggcggatgtggtggaggtcgctcctccgctcgattccgccggc
atcacggcgctggcgggcgccggcatcgccttcgagatcctgtgcctgctggccgagcgg
gtcgccgcacggcactga

DBGET integrated database retrieval system