KEGG   Methylobacterium extorquens AM1: Mex_1p4369Help
Entry
Mex_1p4369        CDS       T00921                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mea  Methylobacterium extorquens AM1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4460949..4462016)
Genome map
AA seq 355 aa AA seqDB search
MSPDPDRDRSFVLAQRSFELMRDYCACATPRAYAVWYLYVSGTQPLMNDAVKRLTTQNGT
LTSADIEGLHDTYIDGRRMAVEVDRMNSSLIAEVEGIMEMIEVSIRSTAQYGESLQALSH
DIANTATSRTRLREVVTTIIANTRDVTANNRTLEARMRESRSEIEALRETLEATRLESLT
DALTGLGNRKSFEESLRKSVDLQSASAQQGKPASLIVIDIDSFKRFNDLYGHLTGDQVLR
LVAIVMREHIGQKNATLARFGGEEFGIVLPETDRVEARAIAERVRIGVTGRELVKRSTGE
SLGKVTVSLGVATQREDDNAVSLLERADACLFAAKRAGRNRTLDETEVENLRDVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgatcccgatcgtgatcgcagtttcgtgctcgcgcagcgcagcttcgagctg
atgcgcgactactgtgcctgcgcgacgccgcgggcctacgccgtgtggtatctctacgtc
tccggcacgcagccgctgatgaacgatgcggtcaaacggctcacgacgcagaacggcacg
ctgaccagcgccgacatcgaggggcttcacgacacctacatcgacggccgccgcatggcc
gtggaggtggaccggatgaattcgagcctcatcgccgaggtcgaaggcatcatggagatg
atcgaggtgtcgatccgctccaccgcccagtacggcgagtcgcttcaggccctgtcccac
gacatcgccaacacggccacgagccggacgcgtctgcgcgaggtcgtcacgacgatcatc
gctaacacccgcgacgtgaccgccaacaaccgcaccctcgaagcgcggatgcgcgagagc
cgcagcgagatcgaggccttgcgcgagacgctggaggcgacccgtctggagagcctgacc
gacgccctgacggggctgggcaaccgcaagagtttcgaggagtcgctccgcaagagcgtc
gatctgcagtctgcctcggcgcagcagggcaagccggcgagcctgatcgtgatcgacatc
gattcgttcaagcgcttcaacgacctctacggccacctgaccggggatcaggtactgcgc
ctcgtcgccatcgtgatgcgcgagcatatcggtcagaaaaacgcgacgctcgcccggttc
ggcggcgaggaattcggcatcgtcctgccggaaaccgaccgggtcgaggcgcgcgccatc
gccgagcgggtgcgcattggcgtcaccggccgcgaactggtgaagcgctccaccggcgaa
tcgctcggcaaggtcacggtctcactcggcgtcgcgacccagcgcgaggacgacaacgcg
gtctccctgctggaacgggccgacgcctgcctgttcgccgccaagcgcgccggccgcaac
cgcaccctcgacgagaccgaagtcgagaacctgcgcgacgtcgcctga

DBGET integrated database retrieval system