KEGG   Methylobacterium extorquens AM1: Mex_1p4381Help
Entry
Mex_1p4381        CDS       T00921                                 

Definition
acyl-CoA thioesterase (tesA-like) (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Mex_1p4381
Enzymes [BR:mea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mex_1p4381
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Mex_1p4381
Lipid biosynthesis proteins [BR:mea01004]
 Fatty acid synthase
  Component type
   Mex_1p4381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4470022..4470741
Genome map
AA seq 239 aa AA seqDB search
MGARREAAAPDVGPRRLRRRAALMLLFAAATLVGAAGLLPGSARAEPSPLKLVAFGDSLT
AGYRLPADAAFPAVLEQALKAKGYRVEIANAGVSGDTSTGGLDRLDWSVPDGTQGVILEL
GANDMLRGTDPAVTRKALETIIARLKERNIPVLLAGMLAAPNLGTEYRARFDAIYPDLAK
AHGLVLYPFFLDGVTGQRANTMDDGLHPTAKGVERIVEGILPSVETFLGRLGQNPEKKG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgcccggcgcgaggcggccgcacccgatgtggggccgcgccgcctccggcgcagg
gccgcgctgatgctcctcttcgccgcagccacgctcgttggcgccgcgggcctgctgccc
ggctcggcccgtgccgagccgtcgccgctcaagctcgtggccttcggcgacagcctcacc
gccggctaccgcctgccggccgacgccgcctttcccgcggtgctggagcaggcgctgaag
gccaaggggtaccgggtcgagatcgccaatgccggcgtgtcgggcgacaccagcaccggc
gggctcgaccggctcgactggtcggtgccggacggcacgcagggcgtgatcctcgaactc
ggcgccaacgatatgctgcgcggcaccgatccggcggtgacccgtaaggcgctcgagacg
atcatcgcgcggctgaaggagcgcaacattccggtgctgctcgccggcatgctggccgcg
ccgaacctcggcacggagtaccgcgcccggttcgacgcgatctatcccgacttggccaag
gcgcacggcctcgtgctctacccgttctttctcgacggcgtgacgggccagcgcgccaac
accatggatgacgggctgcacccgaccgccaagggcgtcgagcggatcgtcgagggcatc
ctgccgagcgtcgagaccttcctgggccgcctgggccagaatccggagaagaaggggtag

DBGET integrated database retrieval system