KEGG   Methylobacterium extorquens AM1: Mex_1p4455Help
Entry
Mex_1p4455        CDS       T00921                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mex_1p4455 (glpK)
Enzymes [BR:mea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mex_1p4455 (glpK)
Exosome [BR:mea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mex_1p4455 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4556768..4558273
Genome map
AA seq 501 aa AA seqDB search
MPDAVGAIDQGTTSTRFIVFDRRGTILAQAQREHEQIFPRPGWVEHDPREIWRNTHAVMR
EGLARAGLAPGDLAAIGITNQRETAVLWDRRTGEPLHDAIVWQDTRTDRSVAALARDGGR
DRFRAVTGLPLASYFSASKLAWLLDHVEGARAKAEDGTALFGTIDSWLVWNLTGGPDGGL
HVTDVTNASRTQLMSLATLDWDEAMLGVFRIPRAVLPTIVSSSAVLGEARDPFPGVPLGG
ILGDQQAALFGQTCFSAGEAKNTYGTGCFALMNTGPAPVASSAGLITTVAYRLDRRPPAY
ALEGSIAITGALVQWLRDNLGLIGASSEIEGLARSVEDNGGVYVVPAFSGLYAPHWRDDA
RGLIIGLTRYANRGHIARACLEATAYQTREVLEAMERDSGCPIAELRCDGGMTVNDLLMQ
FQADILDRPTLRPKVSETTALGAAYAAGLATGFWKTLEDLRDNWAVDKRWHPHIQAEERR
ALFAGWSRAVERSFGWVEENA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccggatgcggtcggggcgatcgaccagggcaccacgagcacgcgcttcatcgtgttc
gaccgccggggcacgatcctggcgcaggcccagcgcgagcacgagcagatctttccccgt
cccggctgggtcgagcacgacccgcgggagatctggcgcaacacccatgcggtgatgcgt
gaggggctggcccgcgccgggctggcgccgggggatttggccgccatcggcatcaccaac
cagcgcgagaccgccgtgctctgggaccggcggaccggcgagcctctgcacgatgccatc
gtctggcaggacacccgcaccgaccggtccgtcgccgcgctcgcccgcgacggggggcgc
gaccgcttccgcgccgtcaccggcctgccgctcgcgagctacttctccgcctccaagctc
gcttggctgctcgaccacgtggagggcgcgcgggcgaaggccgaggacggcaccgccctg
ttcgggacgatcgattcctggctcgtctggaatctcaccggcggcccggatggcgggctc
cacgtcaccgacgtgaccaatgccagccgcacgcagctcatgtcgctcgcgaccctcgat
tgggacgaggcgatgctcggcgtgttccgcatcccgcgggcggtgctgccgacgatcgtc
tcctccagcgccgtgctcggcgaggcccgtgacccgtttcccggcgtgccgctcggcggc
attctgggcgatcagcaggcggcgctgttcgggcagacctgcttttcggcgggcgaggcc
aagaacacctacggcaccggctgcttcgcgctgatgaacaccggccccgcgcccgtcgca
tcgagcgccgggctcatcaccaccgtggcctaccggctcgacaggcgcccgccggcctac
gcgctggagggctccatcgccatcaccggcgccctggtgcagtggctgcgcgacaatctc
gggctgatcggcgcgtcgagcgagatcgaggggctggcccgcagcgtcgaggacaatggc
ggcgtctacgtggtgccggccttctccggcctctacgccccgcattggcgcgacgacgcc
cgcggcctcatcatcggcctgacccgctacgccaatcgcggccacatcgcccgcgcctgc
ctggaggccaccgcctaccagacccgcgaggtgctggaggcgatggagcgcgattccggt
tgtccgatcgccgaactacgctgcgacggcggcatgaccgtcaacgacctgctgatgcag
ttccaggccgacatcctcgaccggccgaccctgcgcccgaaggtttcggagacgacggcc
ctgggcgcggcctatgccgccggcctcgccacagggttttggaagacactcgaagatctt
cgcgacaactgggccgtggacaagcgctggcatccgcatatccaggcagaagaacgtcgg
gcactgttcgccggctggagccgggccgtagaacgctcgttcggatgggtcgaggagaac
gcttga

DBGET integrated database retrieval system