KEGG   Methylobacterium extorquens AM1: Mex_1p4487Help
Entry
Mex_1p4487        CDS       T00921                                 

Definition
phosphatidylethanolamine-N-methyltransferase (pmtA) (EC:2.1.1.17)
Orthology
K00570  
phosphatidylethanolamine/phosphatidyl-N-methylethanolamine N-methyltransferase [EC:2.1.1.17 2.1.1.71]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, PE => PC
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mea00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4592628..4593284
Genome map
AA seq 218 aa AA seqDB search
MLSERAPEAGPTTELMRKAYARWAPVYDVVYDKLTEPAARAAVEAAVAHGPRVLEAGVGT
GLSLGYYPRDSFVCGVDLSEDMLKRARGKVRRKGLTHVKGLQVMDVCRLGYADASFDAVV
AQFLITLVPNPEAALSEFLRVVRPGGGIVLANHFGQSNGPVARVEEIVAPLCTKIGWSSD
FKATRIEAWAQRNGVEVVGLAPTFPGGFFKILRMRKRG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcgagcgggcgcccgaggccgggcccaccaccgagctgatgcgcaaggcctat
gcccgctgggcgccggtctacgatgtcgtctacgacaagctcactgagccggccgcccgc
gccgccgtcgaggccgccgtcgcccacgggccaagggtgctagaggccggcgtcggcacc
ggcctgtcgctcggctactatccccgcgacagcttcgtctgcggcgtcgatctctccgag
gacatgctcaagcgcgcccgcggcaaggtccgccgcaaggggctgacccacgtgaagggc
ctccaggtcatggatgtgtgccgcctcggctacgccgatgcgagcttcgacgccgtggtg
gcgcagttcctcatcaccctggtgccgaacccggaagccgcgctctccgagttcctgcgc
gtggtgcgccccggcggcggcatcgtgctcgccaaccatttcggccagtcgaacgggccg
gtggcgcgggtcgaggagatcgtcgcgccgctctgcaccaagatcggctggtcctcggac
ttcaaggcgacccggatcgaggcctgggcccagcgcaacggcgtcgaggtcgtcggcctc
gcgccgaccttccccggcggcttcttcaagatcctgcgcatgcgcaagcgcggctga

DBGET integrated database retrieval system