KEGG   Methylobacterium extorquens AM1: Mex_1p4513Help
Entry
Mex_1p4513        CDS       T00921                                 

Definition
phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mex_1p4513
   00030 Pentose phosphate pathway
    Mex_1p4513
   00051 Fructose and mannose metabolism
    Mex_1p4513
   00052 Galactose metabolism
    Mex_1p4513
   00500 Starch and sucrose metabolism
    Mex_1p4513
   00520 Amino sugar and nucleotide sugar metabolism
    Mex_1p4513
  Nucleotide metabolism
   00230 Purine metabolism
    Mex_1p4513
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mex_1p4513
Enzymes [BR:mea01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mex_1p4513
    5.4.2.8  phosphomannomutase
     Mex_1p4513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4624409..4625932
Genome map
AA seq 507 aa AA seqDB search
MSFDTSKAFPTPVPKLEPNTFAFEQLPMVKPTGFREYDARWLFPQEINLMGVQALGLGLG
TLIHERGVRPDIVTGHDFRAYSASIKLALIAGMQAAGLQVKDIGLALSPMAYFGQFALDC
PCVAMVTASHNDNGWTGVKMGAERPMTFGPDEMGRLKEIVTTGAFQYRDGGAYEFVSDFA
QVYLDDLVARAKPVSRKLKVVAACGNGTAGAFAPALLERLGVEVIPLDVEPDHSFPRYNP
NPEDMAMLHAIADKVRETGADVGLGFDGDGDRCGVVDDEGEEIFADKIGVMLARDLSKLH
PNATFVVDVKSTGLYAADPELQARGVRTDYWKTGHSYIKRRVNELSALAGFEKSGHFFFN
APVGRGYDDGLLTAIAVIEMLDRNPGQTMADLYRALPKTWGSPTMSPHCADEVKYGVVEA
VTERFRALEAAGEPVGGHSITSLVTVNGVRVTTADGTWGLVRASSNKPELVVVVESPVSE
ARLREMFAAVDGVLRQHPEVGAYNQTI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgatacctccaaggcctttcccacgcccgttccgaagcttgagcccaacacc
ttcgccttcgagcagttgccgatggtcaagcccaccggctttcgcgagtacgacgcccgc
tggctgttcccgcaggagatcaacctgatgggcgtccaggcgctcggcctcggcctcggc
acgctgatccatgagcgcggcgtgcgccccgacatcgtcaccggccacgactttcgcgcc
tactccgcctcgatcaagctcgcgctgatcgccgggatgcaggcggcgggcctgcaggtg
aaggatatcgggctcgcgctctcgccgatggcctatttcggccagttcgccctcgattgc
ccctgcgtggccatggtcacggcctcgcataacgacaacggctggaccggcgtaaagatg
ggcgccgagcgccccatgaccttcggccccgacgagatgggccgcctcaaggagatcgtc
accacgggcgcgttccagtaccgcgacggcggcgcctacgaattcgtctccgacttcgct
caggtctatctcgacgacctcgtggcgcgcgccaaacccgtctcgcgaaagctgaaggtc
gtggcggcctgcggcaacggcacggctggcgccttcgcccctgcgctcctggagcggctc
ggcgtcgaggtgatcccgctcgatgtcgagccggatcactccttcccgcgctacaacccc
aaccccgaggacatggcgatgctgcacgccatcgccgacaaggtgcgcgagaccggcgcc
gatgtcggcctcggcttcgacggcgacggcgaccgctgcggcgtggtcgatgacgagggc
gaggagatcttcgccgacaagatcggcgtcatgctggcccgcgacctgtcgaagcttcac
ccgaacgcgaccttcgtggtcgatgtgaaatcgaccggcctctacgccgctgaccccgag
ttgcaggcccgcggcgtgcgcaccgattactggaagacggggcattcctacatcaagcgc
cgggtcaacgaactctcggcgctcgccggcttcgagaagtcgggccacttcttcttcaac
gcgccggtcggtcgcggctacgacgacggcctgctcacggcgatcgcggtgatcgagatg
ctcgaccgcaatccggggcagaccatggccgacctctaccgggcgctgccgaagacctgg
ggctcgccgaccatgtcgccgcattgcgccgacgaggtgaagtacggcgtggtcgaggcc
gtgaccgagcggttccgggcactcgaggcggcgggcgagccggtgggcggccattcgatc
accagtctcgtgacggtcaacggcgtgcgcgtgaccaccgccgacggcacctgggggctg
gtgcgggcctcctcgaacaagccggagctcgtcgtggtggtcgagagcccggtctccgaa
gcgcggcttcgcgagatgttcgcggcggtggatggggtgctgcgccagcacccggaggtg
ggcgcctacaaccagacgatttga

DBGET integrated database retrieval system