KEGG   Methylobacterium extorquens AM1: Mex_1p4632Help
Entry
Mex_1p4632        CDS       T00921                                 

Definition
enoyl-CoA hydratase/isomerase family protein (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Mex_1p4632
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mex_1p4632
   00650 Butanoate metabolism
    Mex_1p4632
  Lipid metabolism
   00071 Fatty acid degradation
    Mex_1p4632
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mex_1p4632
   00310 Lysine degradation
    Mex_1p4632
   00360 Phenylalanine metabolism
    Mex_1p4632
   00380 Tryptophan metabolism
    Mex_1p4632
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mex_1p4632
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mex_1p4632
   00281 Geraniol degradation
    Mex_1p4632
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mex_1p4632
   00627 Aminobenzoate degradation
    Mex_1p4632
   00930 Caprolactam degradation
    Mex_1p4632
Enzymes [BR:mea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mex_1p4632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4755040..4756200)
Genome map
AA seq 386 aa AA seqDB search
MSGGQQALQQGVAQRDVREPSAEPEIVFETRGEAGLITLTRPKALNALTLPMVEAMHRQL
RAWAGDARVSRIVVRGSGGRAFCAGGDIRQIQALGKAGRHADVMAFWRGEYWLDAAVKSY
PKPYIALIEGIVMGGGVGISLHGDVRVAAENYSFAMPETGIGFFPDVGATYALPRLPGYT
GRYLALTGARIGAGDALAVGLATHAARAEDFETIIERLAGGGAIARAFDGLDAPGTETGP
LVAERTLIDTCFSADTVTEVLARLDAAARDGSAFAGATAATIRTRSPTSLTIALAQMRRG
ADLSFAEAMLAEYRLCERVMRGHDFYEGVRAVIIDKDNRPAWQPATLDAVDAGAIEAAFG
PLDGPEPLFDGSQGPHEASAAAEART
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtgggcaacaggccttgcagcaaggggtcgcgcaacgggacgtgcgtgagccg
tcggccgagcccgagatcgtgttcgagacccgcggcgaggccgggctgatcaccctgaca
cggccgaaggcgctcaatgccctcaccctgccgatggtggaggcgatgcaccggcagctc
cgggcctgggcgggggatgcgcgggtcagccggatcgtggtgcgcggctcgggcgggcgc
gccttctgcgcgggcggcgatatccgccagatccaggccctcggcaaggccgggcgccat
gccgacgtgatggcgttctggcgcggggaatactggctcgacgccgccgtgaagtcctac
ccgaagccctacatcgccctgatcgaagggatcgtgatgggcggcggcgtcggcatctcg
ctgcacggcgacgtacgggtcgccgccgagaactacagcttcgccatgcccgagaccggc
atcggcttcttccccgatgtcggcgcgacctacgccctgccgcgcctgcccggctacacc
gggcgctacctcgcgctgacgggcgcacggatcggcgcgggcgacgcgctcgccgtcgga
cttgcgacccacgcggcgcgggcggaggatttcgagaccatcatcgagcggctggcgggg
ggaggggcgatcgcccgcgccttcgacggcctcgatgcgccggggacggagaccggcccc
ctcgtcgccgagcgaacgctgatcgatacgtgcttctccgccgacaccgtaacggaggtg
ctcgcccggctcgacgcggcagcgcgggacggctccgcttttgccggcgcgaccgcggcg
acgatccgcacccgctcgcccaccagcctgaccatcgccctggcgcagatgcgccgcggg
gccgacttgagctttgccgaggcgatgctcgccgagtaccggctgtgcgagcgggtgatg
cgcgggcacgatttctacgagggtgtgcgggcggtgatcatcgacaaggacaaccggccg
gcctggcagcccgcgaccctggacgcggtcgatgccggggcgatcgaggccgcgttcggc
ccgctcgacggccccgagccgctcttcgacggcagccagggcccgcatgaagcgtcggcc
gccgcggaggcccggacgtga

DBGET integrated database retrieval system