KEGG   Methylobacterium extorquens AM1: Mex_1p4632Help
Entry
Mex_1p4632        CDS       T00921                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00071  Fatty acid degradation
mea00280  Valine, leucine and isoleucine degradation
mea00281  Geraniol degradation
mea00310  Lysine degradation
mea00360  Phenylalanine metabolism
mea00362  Benzoate degradation
mea00380  Tryptophan metabolism
mea00410  beta-Alanine metabolism
mea00627  Aminobenzoate degradation
mea00640  Propanoate metabolism
mea00650  Butanoate metabolism
mea00903  Limonene and pinene degradation
mea00930  Caprolactam degradation
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
mea01130  Biosynthesis of antibiotics
mea01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mex_1p4632
   00650 Butanoate metabolism
    Mex_1p4632
  Lipid metabolism
   00071 Fatty acid degradation
    Mex_1p4632
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mex_1p4632
   00310 Lysine degradation
    Mex_1p4632
   00360 Phenylalanine metabolism
    Mex_1p4632
   00380 Tryptophan metabolism
    Mex_1p4632
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mex_1p4632
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mex_1p4632
   00281 Geraniol degradation
    Mex_1p4632
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mex_1p4632
   00627 Aminobenzoate degradation
    Mex_1p4632
   00930 Caprolactam degradation
    Mex_1p4632
Enzymes [BR:mea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mex_1p4632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ACS42261
UniProt: C5AQY8
Position
complement(4755040..4756200)
Genome map
AA seq 386 aa AA seqDB search
MSGGQQALQQGVAQRDVREPSAEPEIVFETRGEAGLITLTRPKALNALTLPMVEAMHRQL
RAWAGDARVSRIVVRGSGGRAFCAGGDIRQIQALGKAGRHADVMAFWRGEYWLDAAVKSY
PKPYIALIEGIVMGGGVGISLHGDVRVAAENYSFAMPETGIGFFPDVGATYALPRLPGYT
GRYLALTGARIGAGDALAVGLATHAARAEDFETIIERLAGGGAIARAFDGLDAPGTETGP
LVAERTLIDTCFSADTVTEVLARLDAAARDGSAFAGATAATIRTRSPTSLTIALAQMRRG
ADLSFAEAMLAEYRLCERVMRGHDFYEGVRAVIIDKDNRPAWQPATLDAVDAGAIEAAFG
PLDGPEPLFDGSQGPHEASAAAEART
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtgggcaacaggccttgcagcaaggggtcgcgcaacgggacgtgcgtgagccg
tcggccgagcccgagatcgtgttcgagacccgcggcgaggccgggctgatcaccctgaca
cggccgaaggcgctcaatgccctcaccctgccgatggtggaggcgatgcaccggcagctc
cgggcctgggcgggggatgcgcgggtcagccggatcgtggtgcgcggctcgggcgggcgc
gccttctgcgcgggcggcgatatccgccagatccaggccctcggcaaggccgggcgccat
gccgacgtgatggcgttctggcgcggggaatactggctcgacgccgccgtgaagtcctac
ccgaagccctacatcgccctgatcgaagggatcgtgatgggcggcggcgtcggcatctcg
ctgcacggcgacgtacgggtcgccgccgagaactacagcttcgccatgcccgagaccggc
atcggcttcttccccgatgtcggcgcgacctacgccctgccgcgcctgcccggctacacc
gggcgctacctcgcgctgacgggcgcacggatcggcgcgggcgacgcgctcgccgtcgga
cttgcgacccacgcggcgcgggcggaggatttcgagaccatcatcgagcggctggcgggg
ggaggggcgatcgcccgcgccttcgacggcctcgatgcgccggggacggagaccggcccc
ctcgtcgccgagcgaacgctgatcgatacgtgcttctccgccgacaccgtaacggaggtg
ctcgcccggctcgacgcggcagcgcgggacggctccgcttttgccggcgcgaccgcggcg
acgatccgcacccgctcgcccaccagcctgaccatcgccctggcgcagatgcgccgcggg
gccgacttgagctttgccgaggcgatgctcgccgagtaccggctgtgcgagcgggtgatg
cgcgggcacgatttctacgagggtgtgcgggcggtgatcatcgacaaggacaaccggccg
gcctggcagcccgcgaccctggacgcggtcgatgccggggcgatcgaggccgcgttcggc
ccgctcgacggccccgagccgctcttcgacggcagccagggcccgcatgaagcgtcggcc
gccgcggaggcccggacgtga

DBGET integrated database retrieval system