KEGG   Methylobacterium extorquens AM1: Mex_1p4633Help
Entry
Mex_1p4633        CDS       T00921                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mea00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4756863..4757918
Genome map
AA seq 351 aa AA seqDB search
MSDATPRPLAIETAREAAPGAGPLSLTQRPRRNRKADWSRRLVREHSLTVDDLIWPLFVI
EGEKRREPIASMPGVERLSVDEIVREAERAARLGIPAISFFPYTEPSLRDPTGSEALNRE
NLVCRAVRAVKRAVPEIGVMTDVALDPYTSHGHDGLIEAGAILNDETVAVLVEQSLIQAE
AGTDIIAPSDMMDGRVGAIRTGLDRAGFRDVQIMAYAAKYASAFYGPFRDAIGTSAALVG
DKRTYQMDPGNAAEALREVALDLAEGADSVMVKPGLPYLDIITRVKTEFGVPTFAYQVSG
EYAMIEAAARNGWLDGDRAMTESLLAFKRAGADGVLTYYAPRVAERLRAGA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgccaccccgcgcccgctcgccatcgagaccgcgcgcgaagccgcccccggt
gcggggccgctgagcctgacccagcgcccgcgccgcaaccgcaaggcggattggtcgcgc
cgcctcgtgcgcgagcatagcctcaccgtcgatgacctgatttggccgctcttcgtgatc
gagggcgagaagcgccgcgagccgatcgcctccatgcccggcgtcgagcgcctgagcgta
gacgagatcgtgcgcgaggccgagcgcgccgcgcggctcggcatcccggcgatctcgttc
ttcccctacaccgagccgtccctgcgcgatccgaccggctccgaggcgctgaaccgcgaa
aacctcgtctgccgggcggtgcgggcggtgaagcgggccgtccccgagatcggcgtgatg
accgatgtcgcgctagacccctataccagccacggccatgacggcttgatcgaggccggc
gccatcctcaacgacgagaccgtggcggtgctggtcgagcagagcctgatccaggccgag
gccggcaccgacatcatcgccccctccgacatgatggacgggcgcgtcggcgcgatccgc
accggtctcgaccgggccggctttcgcgatgttcagatcatggcctacgccgcgaaatac
gccagcgcgttctacgggccgttccgcgacgccatcggcaccagcgcggcgctggtcggc
gacaagcgcacctaccagatggatcccggcaatgcggccgaggccctgcgcgaggtggcc
ctcgacctcgccgagggtgccgactcggtgatggtcaagcccggcctgccctatctcgac
atcatcacccgcgtgaagacggagttcggtgtgccgaccttcgcctatcaggtgtcgggc
gagtacgcgatgatcgaggccgccgcccgcaacggctggctcgacggcgaccgcgccatg
accgagagcctgctcgccttcaagcgggcgggcgccgacggggtgctgacctactacgcc
ccccgcgtcgccgagcgcctgcgcgcgggcgcctga

DBGET integrated database retrieval system