KEGG   Methylobacterium extorquens AM1: Mex_1p4633Help
Entry
Mex_1p4633        CDS       T00921                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00860  Porphyrin and chlorophyll metabolism
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mex_1p4633 (hemB)
Enzymes [BR:mea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mex_1p4633 (hemB)
Exosome [BR:mea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mex_1p4633 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACS42262
UniProt: C5AQY9
Position
4756863..4757918
Genome map
AA seq 351 aa AA seqDB search
MSDATPRPLAIETAREAAPGAGPLSLTQRPRRNRKADWSRRLVREHSLTVDDLIWPLFVI
EGEKRREPIASMPGVERLSVDEIVREAERAARLGIPAISFFPYTEPSLRDPTGSEALNRE
NLVCRAVRAVKRAVPEIGVMTDVALDPYTSHGHDGLIEAGAILNDETVAVLVEQSLIQAE
AGTDIIAPSDMMDGRVGAIRTGLDRAGFRDVQIMAYAAKYASAFYGPFRDAIGTSAALVG
DKRTYQMDPGNAAEALREVALDLAEGADSVMVKPGLPYLDIITRVKTEFGVPTFAYQVSG
EYAMIEAAARNGWLDGDRAMTESLLAFKRAGADGVLTYYAPRVAERLRAGA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgccaccccgcgcccgctcgccatcgagaccgcgcgcgaagccgcccccggt
gcggggccgctgagcctgacccagcgcccgcgccgcaaccgcaaggcggattggtcgcgc
cgcctcgtgcgcgagcatagcctcaccgtcgatgacctgatttggccgctcttcgtgatc
gagggcgagaagcgccgcgagccgatcgcctccatgcccggcgtcgagcgcctgagcgta
gacgagatcgtgcgcgaggccgagcgcgccgcgcggctcggcatcccggcgatctcgttc
ttcccctacaccgagccgtccctgcgcgatccgaccggctccgaggcgctgaaccgcgaa
aacctcgtctgccgggcggtgcgggcggtgaagcgggccgtccccgagatcggcgtgatg
accgatgtcgcgctagacccctataccagccacggccatgacggcttgatcgaggccggc
gccatcctcaacgacgagaccgtggcggtgctggtcgagcagagcctgatccaggccgag
gccggcaccgacatcatcgccccctccgacatgatggacgggcgcgtcggcgcgatccgc
accggtctcgaccgggccggctttcgcgatgttcagatcatggcctacgccgcgaaatac
gccagcgcgttctacgggccgttccgcgacgccatcggcaccagcgcggcgctggtcggc
gacaagcgcacctaccagatggatcccggcaatgcggccgaggccctgcgcgaggtggcc
ctcgacctcgccgagggtgccgactcggtgatggtcaagcccggcctgccctatctcgac
atcatcacccgcgtgaagacggagttcggtgtgccgaccttcgcctatcaggtgtcgggc
gagtacgcgatgatcgaggccgccgcccgcaacggctggctcgacggcgaccgcgccatg
accgagagcctgctcgccttcaagcgggcgggcgccgacggggtgctgacctactacgcc
ccccgcgtcgccgagcgcctgcgcgcgggcgcctga

DBGET integrated database retrieval system