KEGG   Methylobacterium extorquens AM1: Mex_1p4657Help
Entry
Mex_1p4657        CDS       T00921                                 

Gene name
pcm
Definition
L-isoaspartate protein carboxylmethyltransferase type II (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mea  Methylobacterium extorquens AM1
Brite
Enzymes [BR:mea01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mex_1p4657 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4779957..4780577
Genome map
AA seq 206 aa AA seqDB search
MVETQLVARGIRDAAVLDAMRAVPREAFVPDALAGEAYDDGPLPIGAGQTISQPYIVALM
IEALALRPGDRVLEVGAGCGYAAAVLARMGAQVFAIERHAALGEAARARLAALGLTVSLR
VGDGHAGWPEAAPFDAVLVSAAGSTIPEALKAQLKPRGRLVIPVGPPGGQTLLRLTRRGR
DRFESRDFGPVSFVPLLRGVGTADPV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagacgcaactggtcgcccgcggcatccgtgacgcggccgtcctcgatgcgatg
cgggccgtgccgcgggaggccttcgtgccggacgctctggcgggggaggcctacgacgac
gggccgctgccgatcggggcggggcagacgatctcccagccctacatcgtcgccctgatg
atcgaggcgctggccctgcggcccggcgaccgggtgctggaggtcggcgccggttgcggc
tacgcagcggcggtgctggcgcggatgggcgcgcaggtcttcgccatcgagcgccacgcg
gcgttgggcgaggccgctcgcgcgcgcctcgccgcactcgggctcacggtgtctctgcgc
gtcggcgacggccatgcgggctggccggaggccgcgcccttcgacgcggtcctcgtctct
gcggcgggctccacgatccccgaggcgttgaaggcccagctcaagcctcgtggccgcctc
gtcatcccggtcggcccgcccggcgggcagacgctgctgcggctgacccggcgcgggcgg
gaccggttcgagagccgcgatttcggcccggtctccttcgtgccgctgctgcgaggcgtg
gggacggcggaccccgtgtga

DBGET integrated database retrieval system