KEGG   Methylobacterium extorquens AM1: Mex_1p4840Help
Entry
Mex_1p4840        CDS       T00921                                 

Definition
(GenBank) putative Glucokinase (Glucose kinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00010  Glycolysis / Gluconeogenesis
mea00052  Galactose metabolism
mea00500  Starch and sucrose metabolism
mea00520  Amino sugar and nucleotide sugar metabolism
mea00521  Streptomycin biosynthesis
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
mea01130  Biosynthesis of antibiotics
mea01200  Carbon metabolism
Module
mea_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mex_1p4840
   00052 Galactose metabolism
    Mex_1p4840
   00500 Starch and sucrose metabolism
    Mex_1p4840
   00520 Amino sugar and nucleotide sugar metabolism
    Mex_1p4840
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mex_1p4840
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mex_1p4840
Enzymes [BR:mea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mex_1p4840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACS42449
UniProt: C5ARW1
Position
complement(4947437..4948438)
Genome map
AA seq 333 aa AA seqDB search
MFEFPVLIGDIGGTNARFGLIETRGAPPRLLSREATHGHPDPSAAIRASLAQGGGPAPRS
AILAIAGRVDAPAVQLTNADWLVDAAAIARDFGLARVALVNDYVPVAAGAAGIAPDDLTP
IGPSRGDASGPRLVLGPGTGFGAAALIPYEDRLAIVSTEAGHTDLGPTDAEEFEIWPAVE
RVEGRVTVETLLSGPGLARICAAIRAVRAGGDGSLCDPAEITSSGLSGEDPHAHAALALF
SKLLGRVCGDLALTFLATGGVYIGGGIAPRIVSVLREGAFREAFERKAPFAEQMRTIPTS
VITVKDPAFSGLAALASESERFVYHGHAWTPQT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaattcccggtgctgatcggcgatatcggcgggaccaatgcccgcttcggcctg
atcgaaacgcggggggcgccgccccgcctcctctcgcgcgaggcgacgcacggccatccc
gatccgagcgcggcgatccgggcctccctggcgcagggcggcgggcccgcgccgcgctcg
gcgatcctggcgatcgcgggccgggtcgatgcgccggcggtccagctcaccaacgcggac
tggctggtggacgccgccgcgatcgcccgtgatttcgggctcgcgcgggtcgccctcgtc
aacgattacgtgccggtcgccgcgggcgcggccggcatcgcgcccgacgacctcacgccg
atcggtccaagtcgcggtgacgcaagcgggccgcgcctcgtgctcgggccgggcaccggc
ttcggcgccgccgccctgatcccttacgaggaccgcctcgccatcgtctcgacggaggcc
ggccacaccgatctcgggccgaccgatgcggaggagttcgagatctggccggcggtcgag
cgtgtcgaggggcgggtcacggtggagacgctgctctccggtcccggtctcgcccggatc
tgcgcggcgatccgcgcggtgcgggcgggcggcgacggttccttgtgcgatccggccgag
atcacgagcagcggcctctcgggcgaggatccgcatgcacacgccgcgctcgcgctgttc
agcaagctgctgggccgggtatgcggggatctggcgctgaccttccttgccaccggcggg
gtctatatcggcggcggcatcgccccgcggatcgtctccgtcctgcgggagggcgcgttc
cgcgaggctttcgagcgcaaggcgcccttcgccgagcagatgcgcaccatccccaccagc
gtcatcaccgtgaaggatcccgccttcagcggcctcgcggcactggcgagtgaaagcgag
cgcttcgtctatcacgggcatgcctggacaccgcagacgtaa

DBGET integrated database retrieval system