KEGG   Methylobacterium extorquens AM1: Mex_1p4890Help
Entry
Mex_1p4890        CDS       T00921                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mex_1p4890 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mex_1p4890 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mex_1p4890 (trpA)
Enzymes [BR:mea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mex_1p4890 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5005636..5006478)
Genome map
AA seq 280 aa AA seqDB search
MTARIDAAFARCRAEGRAALVTYVMAGDPDPETSLKVLEALPKAGADIVEFGLPFTDPMA
DGPAIQAAGLRALKAGQDLRGTLALVRRFREGDDRTPVVLMGYYNPIHTYGVPHFLEDAQ
AAGIDGLIVVDLPPEEDEELCLPALAKGLAFIRLATPTTDEARLPAVLANTAGFVYYVSI
TGVTGTATPDFGRVSQAVSRITAHTDLPVVVGFGVKTGAHAAEIARGADGVVVGSALVDA
LARSLEPGDRAGNGTVEAVTSLVRELAQGVRSAAKAPAGP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcatcgatgccgccttcgcccgctgccgcgcggaaggacgtgccgccctc
gtcacctacgtgatggccggcgatcccgatccggagacctcgctcaaggtgctcgaagcc
ctgccaaaggcgggggccgacatcgtcgagttcggcctgcccttcaccgatcccatggcc
gacgggccggcgatccaggcggcgggtctgcgggcgctgaaggcgggccaggatctgcgc
ggcaccctcgccctcgtccgccgcttccgcgagggcgacgaccggacgcccgtggttctg
atgggctactacaacccgatccatacctacggcgtgccccactttctggaggatgcgcag
gcggccggcatcgacggtctgatcgtcgtcgatctgccgccggaggaggacgaggagctc
tgcctgccggcgctcgcgaaggggctcgccttcatccgcctcgcgaccccgaccacggac
gaggcccgcctgccggcggttctcgcgaacaccgcgggcttcgtctactacgtgtcgatc
accggcgtgaccggcacggcgacccccgatttcggccgggtgtcgcaggcggtcagccgg
atcacggcgcataccgacctacccgtcgtcgtcggcttcggcgtgaagaccggcgcgcac
gcggccgagattgcccgcggcgccgacggcgtggtggtgggctcggccctcgttgatgcg
ctggcccgcagcctcgagcccggcgaccgggccgggaacggcacggtggaggcggtcacc
tccctggtgcgcgaactggcgcagggggtccgcagcgccgccaaggcgccggccgggccc
tga

DBGET integrated database retrieval system