KEGG   Methylobacterium extorquens AM1: Mex_1p5115Help
Entry
Mex_1p5115        CDS       T00921                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00010  Glycolysis / Gluconeogenesis
mea00051  Fructose and mannose metabolism
mea00562  Inositol phosphate metabolism
mea00710  Carbon fixation in photosynthetic organisms
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
mea01130  Biosynthesis of antibiotics
mea01200  Carbon metabolism
mea01230  Biosynthesis of amino acids
Module
mea_M00002  Glycolysis, core module involving three-carbon compounds
mea_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mex_1p5115 (tpiA)
   00051 Fructose and mannose metabolism
    Mex_1p5115 (tpiA)
   00562 Inositol phosphate metabolism
    Mex_1p5115 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mex_1p5115 (tpiA)
Enzymes [BR:mea01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mex_1p5115 (tpiA)
Exosome [BR:mea04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mex_1p5115 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mex_1p5115 (tpiA)
  Exosomal proteins of melanoma cells
   Mex_1p5115 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: ACS42719
UniProt: C5AU20
Position
complement(5266932..5267696)
Genome map
AA seq 254 aa AA seqDB search
MASEGRRPLVAGNWKMNGLLSSVPTVEAIRDGLSPALADKIDVLICPPATLISSCVAAVY
GSVVAIGGQNLHARPSGAFTGSISAEMFADLGATYVIVGHSERRAYHYETDDGVHAKALG
ARRAGLRGIICVGETMEERQQGRALDIVRAQLAIGLPKGATGADTVIAYEPVWAIGSGRT
PTATEIAEVHASLREMLDKLVGEEAHKIRILYGGSVKPSNARELMAVENVDGALVGGASL
VAEDFLGICRAYEG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagggacgccgtccgctggttgccggcaactggaagatgaacggtctgctc
tcctcggtcccgaccgtggaggcaatccgtgacgggctctcgccggcgctcgcggacaag
atcgacgtgttgatctgcccgcccgcgacgctgatctcctcctgcgtggcggcggtctac
ggctccgtggtcgccatcggcggtcagaacctgcacgcccggccgagcggcgccttcacc
ggttcgatctcggcggagatgttcgccgatctcggcgcaacctacgtcatcgtcggccat
tccgagcggcgcgcctaccattacgagaccgatgacggcgtccacgccaaggcgctcggc
gctcgccgcgcgggcctgcgcggcatcatctgcgtcggcgagacgatggaggagcgccag
cagggccgggcgctcgacatcgtgcgcgcgcagctcgcgatcggcttgccgaagggcgcc
accggcgccgacacggtgatcgcctacgagccggtctgggcgatcggctcgggccgcacg
ccgacggcgacggagatcgccgaggtccacgcctccttgcgcgagatgctcgacaagctc
gtcggcgaggaggcgcacaagatccgcatcctctacggcggctcggtgaagccctcgaac
gcccgcgaactgatggcggtggagaacgtcgacggcgcgctggtcggcggcgccagcctc
gtggcggaggactttttggggatctgccgcgcttacgaggggtga

DBGET integrated database retrieval system