KEGG   Methylobacterium extorquens AM1: Mex_1p5115Help
Entry
Mex_1p5115        CDS       T00921                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mex_1p5115 (tpiA)
   01230 Biosynthesis of amino acids
    Mex_1p5115 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mex_1p5115 (tpiA)
   00051 Fructose and mannose metabolism
    Mex_1p5115 (tpiA)
   00562 Inositol phosphate metabolism
    Mex_1p5115 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mex_1p5115 (tpiA)
Enzymes [BR:mea01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mex_1p5115 (tpiA)
Exosome [BR:mea04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mex_1p5115 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mex_1p5115 (tpiA)
  Exosomal proteins of melanoma cells
   Mex_1p5115 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5266932..5267696)
Genome map
AA seq 254 aa AA seqDB search
MASEGRRPLVAGNWKMNGLLSSVPTVEAIRDGLSPALADKIDVLICPPATLISSCVAAVY
GSVVAIGGQNLHARPSGAFTGSISAEMFADLGATYVIVGHSERRAYHYETDDGVHAKALG
ARRAGLRGIICVGETMEERQQGRALDIVRAQLAIGLPKGATGADTVIAYEPVWAIGSGRT
PTATEIAEVHASLREMLDKLVGEEAHKIRILYGGSVKPSNARELMAVENVDGALVGGASL
VAEDFLGICRAYEG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagggacgccgtccgctggttgccggcaactggaagatgaacggtctgctc
tcctcggtcccgaccgtggaggcaatccgtgacgggctctcgccggcgctcgcggacaag
atcgacgtgttgatctgcccgcccgcgacgctgatctcctcctgcgtggcggcggtctac
ggctccgtggtcgccatcggcggtcagaacctgcacgcccggccgagcggcgccttcacc
ggttcgatctcggcggagatgttcgccgatctcggcgcaacctacgtcatcgtcggccat
tccgagcggcgcgcctaccattacgagaccgatgacggcgtccacgccaaggcgctcggc
gctcgccgcgcgggcctgcgcggcatcatctgcgtcggcgagacgatggaggagcgccag
cagggccgggcgctcgacatcgtgcgcgcgcagctcgcgatcggcttgccgaagggcgcc
accggcgccgacacggtgatcgcctacgagccggtctgggcgatcggctcgggccgcacg
ccgacggcgacggagatcgccgaggtccacgcctccttgcgcgagatgctcgacaagctc
gtcggcgaggaggcgcacaagatccgcatcctctacggcggctcggtgaagccctcgaac
gcccgcgaactgatggcggtggagaacgtcgacggcgcgctggtcggcggcgccagcctc
gtggcggaggactttttggggatctgccgcgcttacgaggggtga

DBGET integrated database retrieval system