KEGG   Methylobacterium extorquens AM1: Mex_1p5121Help
Entry
Mex_1p5121        CDS       T00921                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mea01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mea00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5275136..5275993
Genome map
AA seq 285 aa AA seqDB search
MDDIVADVTVGPATSTPERASVLARIEAYKRREIAEAKLRLPLAKLEKQVAKADPPRGFA
DAIARHIAEGRPALIAEIKKASPSKGLIRADFDPKTLAKAYAKGGATCLSVLTDTPSFQG
APDFLIEARAACDLPVLRKDFMFEPYQVYEARAWGADCILVIMACLDDAEAAAITETAHD
LGMDVLVEVHDAQELERALPLGTRLVGVNNRNLKTFEVSFETAITLKPGIPADRIAVAES
GIGGHADVLRLKQHGLNTVLVGESLMRQDDVTAATRSLLFGEQGR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatcgtggccgacgtgaccgtcgggcctgccacctcgaccccggagcgggcg
agcgtgctggcccggatcgaggcctataagcgtcgcgagatcgccgaggcgaagctgcgt
ctgccgctggccaagctggaaaagcaggtcgccaaagccgacccgccccgcggctttgct
gacgccatcgcccggcatatcgcggaaggccgtccggccctgatcgccgagatcaagaag
gcctccccctccaaggggctgatccgcgccgatttcgacccgaagacgctggccaaggcc
tacgcaaagggcggcgccacctgcctttcggtgctgaccgacacgccctccttccagggc
gcaccggacttcctgatcgaggcgcgggcggcttgcgacctgccggtcctgcgaaaagac
ttcatgttcgagccgtatcaggtctacgaggcccgcgcctggggcgccgattgcatcctc
gtcatcatggcctgcctcgatgacgcggaggccgccgccatcaccgagaccgcgcacgat
ctcggcatggacgtgctggtcgaggtccacgacgcgcaggaactggagcgggccctgccg
ctcggcacccgtctggtcggcgtcaacaaccgcaacctcaagaccttcgaggtctccttc
gagaccgcgatcaccctgaagcccggtatcccggccgaccggatcgcggtggccgagagc
ggcatcggcggacatgccgacgtgctgcggctgaagcagcacgggctcaacaccgtcctc
gttggcgagagcctgatgcggcaggacgacgtgaccgcggcgacgcgctccctgctgttc
ggggagcagggccggtga

DBGET integrated database retrieval system