KEGG   Methylobacterium extorquens AM1: Mex_1p5180Help
Entry
Mex_1p5180        CDS       T00921                                 

Gene name
matA
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mea  Methylobacterium extorquens AM1
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mea00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mea00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5332779..5334188
Genome map
AA seq 469 aa AA seqDB search
MAAISFLGDLIQTISDRGRDLIGLARSDLARTASAADLARFCEDLISRRGEASGVALARL
ILDRYAAFPLEDRLAFLELIATEFGADHDAVDAAIAAYRADPTRARLGLLHVAAEPRSQE
LIRRLNLARGGTLALVRMREDLFTLRKRLKDREAAPETIDAAVSLDSDFEHLFASWFNRG
FLVLRPIDWSTPADILEKIIRYEAVHEIADWDELRRRIQPTDRRCFAFFHPALLDEPLIF
VEVALTNAIAPAIQPILADGREPVPARSATTAIFYSISNCQKGLAGVTFGNFLIKQVVED
LAREIPSLKTFVTLSPVPGFRTWLDRERGADAPQGLTREDVEALRLLDTEDWRSDKTKCE
AVRRAMLPAAAAYFLRAKNEKGRPLDPVARFHLGNGARLERMNFLGDTSKKGLKQSYGLM
VNYLYDLSAIEKNHETYVNLGTVATSSAVSRELRSNLPPPRAVVLAEAG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatctcgttcctcggcgatctcatccagaccatcagcgaccggggccgggac
cttatcggcttggcccgctccgatctggcgcggacggcgagcgcggccgacctcgcccgg
ttctgcgaagacctgatttcccggcgcggcgaagcctcgggcgtcgcactcgcgcgcttg
atcctcgatcgctacgctgcctttccccttgaggaccggctcgccttcctcgaactcatc
gccaccgaattcggtgccgaccacgatgcggtcgatgccgcgatcgccgcttaccgtgcc
gatccgacgcgggcccggctcggcctgttgcacgtagccgccgagccgcgctcacaggaa
ctgattcggcgactcaacctcgcccgcggcggcaccctggcgctggtgcggatgcgcgag
gatctgttcacgctccgcaagcgcctgaaggaccgggaggccgccccggagacgatcgac
gcggcggtgagcctcgacagcgatttcgagcacctgttcgcctcttggttcaatcggggc
ttcctcgttttgcgcccgatcgactggtcgacgccggctgacatcctcgagaagatcatc
cgctacgaggcggtccacgagatcgccgattgggacgaattgcgccgccgcatccagccg
acggatcggcgctgcttcgccttcttccacccagccctgctcgacgagccgctgatcttc
gtcgaggtggcgctcaccaacgccatcgctccggcgatccaaccgatcctggccgacggg
cgcgaaccggtgcccgcgcgcagcgccacgaccgcgatcttctactcgatctcgaactgc
cagaagggcttggccggcgtcaccttcggcaacttcctcatcaagcaggtggtcgaggat
ctcgcccgcgagattccctcgctgaagaccttcgtcaccctctcgccggtgcccggcttc
cgcacctggctcgaccgggagcgtggcgccgacgcgccgcagggcctgacgcgggaggat
gtggaggcgctgcgcctgctcgataccgaggattggcgcagcgacaagacgaagtgcgag
gcggtgcgacgcgccatgctgcccgcggcggcggcctatttcctgcgcgccaagaatgag
aagggccgcccgctcgatccggtggcccgcttccatctcggcaacggcgcccggctggag
cggatgaacttcctcggcgacacctcgaagaagggcctgaagcaatcctacgggctgatg
gtgaactacctctacgatctctcggcgatcgagaagaaccacgagacctacgtcaatctc
ggtaccgtcgcgacctcctcggcggtcagccgcgaactgcgctccaacctgccgccgccg
cgggcggtggtgctggccgaggcgggctga

DBGET integrated database retrieval system