KEGG   Methylobacterium extorquens AM1: Mex_1p5182Help
Entry
Mex_1p5182        CDS       T00921                                 

Gene name
hbd
Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mex_1p5182 (hbd)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mex_1p5182 (hbd)
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mex_1p5182 (hbd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5334835..5335596)
Genome map
AA seq 253 aa AA seqDB search
MVTGSTSGIGLAIAKSFAKDGANVVLNGFGNPEDIERTRSGIESEFGVKAVYSPADLTKP
DEIGGLIALSVETFGSIDILVNNAGIQYVSPIEDFPVEKWDQIIALNLCSAFHTLRAAVP
HMKANGWGRVINTASAHSMVASPYKSAYVAAKHGVVGLTKTAALELATHGITVNCISPGY
VWTPLVESQIPDTMKARGLTKEQVIEEVLLKAQPTKEFVTIDQVAALALFLCTDSASQIT
GANIAMDGGWTAQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaccggctcgacgagcggcatcggactcgccatcgccaagagcttcgccaaggac
ggcgcgaacgtggtcctcaacggattcggcaaccccgaagacatcgagcggacccgcagc
ggcatcgagagcgagttcggggtcaaggcggtctattcgcccgccgacctcaccaagccg
gacgagatcggcgggctgatcgcgctctcggtcgagacgttcggcagcatcgacatcctc
gtgaacaatgcgggcatccagtatgtctcgccgatcgaggactttccggtcgagaagtgg
gaccagatcatcgccctcaatctctgctcggccttccacaccctgcgtgcggccgtgccg
cacatgaaggcgaatggctggggccgggtcatcaacacggcttcggcccactcgatggtc
gcctcgccctacaagtcggcctacgtcgcggccaagcacggcgtcgtcggcctcaccaag
acggcggcgctcgaactcgccacccacggcatcactgtgaattgcatctcaccgggctat
gtctggacgccgctggtggagagccagatcccggacacgatgaaggcgcgcggcctcacc
aaggagcaggtgatcgaggaggtgctgctcaaggcgcagccgaccaaggaattcgtgacg
atcgatcaggtagcggcgctcgccctgttcctgtgcacggacagcgccagccagatcacc
ggtgccaacatcgccatggatggcggctggacggcgcagtag

DBGET integrated database retrieval system