KEGG   Methylobacterium extorquens AM1: Mex_1p5325Help
Entry
Mex_1p5325        CDS       T00921                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mex_1p5325
Enzymes [BR:mea01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mex_1p5325
Peptidases [BR:mea01002]
 Cysteine Peptidases
  Family C44
   Mex_1p5325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5491279..5493048
Genome map
AA seq 589 aa AA seqDB search
MCGICGEINFGGIADPNAVRAMMEVLRPRGPDAGGLHGQGGVLFGHCRLKIIDLSEAGQQ
PMVDAELGLSVVFNGCIYNYKDLREELVAKGYRFFSTSDTEVVLKAFHAWGRDCVKRFLG
MFVFAVHERDTGRVTLARDRLGIKPLYYAETGKRFRFASSLPALLAAGDVDTTIDKVALH
HYMSWHAGVPAPLTILKGVRKVHPATTLTFEPDGSRREETYWSLVVGPREEDRHRTEADW
RAAVLDSLTRAVARRQIADVPTGVLLSGGLDSSVIVALLAKSGQSGLKTFSVGFDAVNGV
EGDEFKYSDIIAERFETDHAKLIVDGSRTLEALPAAIHAMAEPQMSHDAVAFLLLSQEVA
KHVKVIQSGQGADEVFGGYHWYPKLMGSTDPTTDYANAYFDRDHAEMREALTPDFVDEDY
SRDFIARFFADSQSASAIDKTLDLDQRIMLVDDPVKRVDNMTMAWGLEARVPFLDHELVE
LAARIPAELKVRDGGKYILKEAARAVVPAEVIDRPKGYFPVPALKHIRGPFMEFVRDVLD
RPAARERGIFNRTYVDRLLADPDGTLTPKGNSKLWQVALLEAWLQSHGI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatctgcggagagatcaacttcggcgggatagccgatccgaacgccgtgcgg
gcgatgatggaggttctgcgcccccgcggtcctgatgcgggcgggctccatggccagggc
ggcgtcctgttcggccattgccgtctgaagatcatcgatctgtcggaagccggccagcag
ccgatggtcgatgccgagctcgggctttcggtcgtcttcaacggctgcatctacaactac
aaggacctgcgcgaggagctcgtcgccaagggctaccgcttcttctcgaccagcgacacc
gaggtggtgctcaaggcgttccacgcctggggtcgggactgcgtgaagcgcttcctcggc
atgttcgtcttcgccgtccacgaacgcgatacgggccgggtcacgctcgcccgcgaccgg
ctcggcatcaagccactctactacgccgagaccggcaagcgcttccgcttcgcttcctcg
ctgccggccctgctcgcagcgggcgatgtcgacaccacgatcgataaggtggcgctccac
cactacatgagctggcacgcgggcgtgccggcgccgctgacgatcctcaagggcgtgcgg
aaggtccacccggccacgacgctgacgttcgagcccgatggctcgcgacgcgaagagacc
tactggtcgcttgtggtcggtccgcgcgaggaggaccgccacaggaccgaggcggattgg
cgcgcggcggtgctcgactcgctcaccagggcggtcgcgcgccgtcagattgccgacgtg
cccaccggcgtgctgctgtcgggcggtctcgattcctcggtgatcgtcgccctgctggcc
aagagcggtcagagcggcctcaagaccttttcggttggcttcgacgcggtgaacggcgtc
gagggcgacgagttcaagtactcggacatcatcgccgagcggttcgagaccgaccacgcc
aagctcatcgtggacggctcgcgcacgctggaggccctgccggcggcgatccatgccatg
gccgagccgcagatgagccacgacgcggtggccttccttctgctgtcgcaggaagtcgcc
aaacacgtgaaggtgatccagagcggtcagggcgccgacgaggtgttcggcggctaccat
tggtatccgaagctgatgggatcgaccgacccaacgacggattacgcgaacgcctatttc
gatcgcgaccacgcggagatgcgcgaagcgctcacacccgatttcgtggacgaggactac
agccgcgacttcatcgcccgcttctttgccgactcgcagagcgcgagcgccatcgacaag
accctcgacctcgatcagcggatcatgctcgtggacgatccggtcaagcgggtcgacaac
atgaccatggcctgggggcttgaggcgcgcgtcccgttcctcgatcacgaactggtcgag
ctcgccgcccgcatccccgccgaactgaaggtgcgcgacggcggcaagtacatcctcaag
gaggccgcccgcgcggtggtgccggccgaggtgatcgaccggccgaagggctattttccg
gtcccggccctgaagcacatccgcgggccgttcatggagttcgtgcgcgacgttctcgac
cgtccggccgcccgcgagcgcggtatcttcaaccggacgtacgtcgatcgcctgctcgcc
gatcccgacggaacgctgacgccgaagggcaattccaagctctggcaggtcgcgctgctc
gaagcgtggctgcaatcgcacggcatctga

DBGET integrated database retrieval system