KEGG   Methylobacterium extorquens AM1: Mex_2p1128Help
Entry
Mex_2p1128        CDS       T00921                                 

Definition
(GenBank) Cytochrome c family protein
  KO
K08738  cytochrome c
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mea00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mex_2p1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACS43901
UniProt: C5B619
Position
megaplasmid:1059679..1060185
Genome map
AA seq 168 aa AA seqDB search
MIERVTRPFRLPSHSQHAMLLALAFLVTACSDDSQERRRSLGDTPSFSEFMRVADAGRGG
RLFGQCAACHTVRMGAGDRSGPGLYDVVGKPVATNSRRFGYTGSLRSLGGVWTPERLDVW
LAAPAKFVPGTSMSFRGLPDPLDRADVIAYLQTQAVEAEGVEALPSRP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacgggtgacgcgccccttccgccttccctcacacagccagcacgccatgctg
ctcgcactggccttcctcgtcacggcctgctcggatgatagccaagagcgccgccgttcg
ctgggcgacaccccgagcttcagcgaattcatgcgggtggccgacgctgggcgaggcggc
cgcttgttcggccagtgcgccgcctgtcacacggtcaggatgggggccggcgaccgaagc
ggccccggcctctacgacgtagttggcaagcccgtcgccaccaatagccgtcgcttcggc
tacaccgggtcgctccggtcattgggcggcgtctggacgccggagaggctggacgtctgg
cttgccgcccctgcgaagttcgtgccgggcacaagcatgagtttccgcggacttccggac
ccgctcgaccgggcggatgtcatcgcatacctccagacgcaggcggttgaggccgagggc
gttgaggcgctgccctcgcggccttga

DBGET integrated database retrieval system