KEGG   Methylobacterium extorquens AM1: Mex_2p1128Help
Entry
Mex_2p1128        CDS       T00921                                 

Definition
Cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
mea  Methylobacterium extorquens AM1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mea00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mea02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:1059679..1060185
Genome map
AA seq 168 aa AA seqDB search
MIERVTRPFRLPSHSQHAMLLALAFLVTACSDDSQERRRSLGDTPSFSEFMRVADAGRGG
RLFGQCAACHTVRMGAGDRSGPGLYDVVGKPVATNSRRFGYTGSLRSLGGVWTPERLDVW
LAAPAKFVPGTSMSFRGLPDPLDRADVIAYLQTQAVEAEGVEALPSRP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacgggtgacgcgccccttccgccttccctcacacagccagcacgccatgctg
ctcgcactggccttcctcgtcacggcctgctcggatgatagccaagagcgccgccgttcg
ctgggcgacaccccgagcttcagcgaattcatgcgggtggccgacgctgggcgaggcggc
cgcttgttcggccagtgcgccgcctgtcacacggtcaggatgggggccggcgaccgaagc
ggccccggcctctacgacgtagttggcaagcccgtcgccaccaatagccgtcgcttcggc
tacaccgggtcgctccggtcattgggcggcgtctggacgccggagaggctggacgtctgg
cttgccgcccctgcgaagttcgtgccgggcacaagcatgagtttccgcggacttccggac
ccgctcgaccgggcggatgtcatcgcatacctccagacgcaggcggttgaggccgagggc
gttgaggcgctgccctcgcggccttga

DBGET integrated database retrieval system