KEGG   Methanobrevibacter sp. AbM4: Abm4_0153Help
Entry
Abm4_0153         CDS       T02687                                 

Definition
(GenBank) carbohydrate kinase PfkB family
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
meb  Methanobrevibacter sp. AbM4
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:meb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Abm4_0153
   00240 Pyrimidine metabolism
    Abm4_0153
Enzymes [BR:meb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Abm4_0153
    2.7.1.213  cytidine kinase
     Abm4_0153
    2.7.1.-  
     Abm4_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
199453..200373
Genome map
AA seq 306 aa AA seqDB search
MDENPKLLVIGHTASDVIIQVNDFPKINTSTHMESMKKLYGGAGANVAMVAAICGLDTTL
VSAVGENFKQSDYYNSFEDNNINTDYLIYVEGEPNATAIMVNNDNSDQVTYFYEGAGGKF
SNYDVPVEAIDKVDFVHLATGDPDYNWKASCEAKRQGKGVSFDPGQDLTIYPAERLKQVI
ENSTILFGNNYEIDRIINILGMDIDGLLGLGPEIIIKTCRENGSILYTKEGKITVDAISR
PAVDPTGAGDSYKAAFLYYYLNDKSLEEAIKFASSVSSFIVEKQGCQTNIPSLQQALERM
NSFYDD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaccctaaattattggttattggacacacagcctcagatgttattattcag
gttaatgattttccaaaaataaatacatctacccatatggagtctatgaaaaaattatat
gggggtgctggtgccaatgtagctatggttgcagctatttgtggattagatactacttta
gtctctgctgtaggtgagaactttaaacaatctgattattataactcttttgaggataac
aatattaatacagattatttaatctatgtggaaggggaacctaacgccacagctatcatg
gtaaacaatgataatagtgatcaggtaacttatttctatgaaggtgcaggaggtaaattc
tccaattatgatgtgcctgtagaggctattgataaagttgattttgtacatcttgcaaca
ggcgatccagactataattggaaggcatcttgcgaggctaaaaggcaaggtaagggcgtg
tcatttgatccaggtcaggacttaaccatatatcctgcagaaagacttaaacaggtcatt
gaaaattccaccatattattcggtaataattatgagattgatagaatcataaatatctta
ggtatggatatcgatggtttacttggtttaggtcccgaaataattattaaaacatgtagg
gagaatggtagtatattgtataccaaagagggtaaaattactgtagatgccatttcaaga
cctgccgtagatccaacaggcgcgggagattcatataaagctgcatttttatattattac
cttaatgacaaatctttagaagaggctattaaattcgcatcttctgtttcctcatttatt
gttgaaaaacagggatgtcaaaccaatatcccttcacttcaacaagctttagaaaggatg
aactcattttatgatgattaa

DBGET integrated database retrieval system