KEGG   Methanobrevibacter sp. AbM4: Abm4_0153Help
Entry
Abm4_0153         CDS       T02687                                 

Definition
carbohydrate kinase PfkB family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
meb  Methanobrevibacter sp. AbM4
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:meb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Abm4_0153
Enzymes [BR:meb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Abm4_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
199453..200373
Genome map
AA seq 306 aa AA seqDB search
MDENPKLLVIGHTASDVIIQVNDFPKINTSTHMESMKKLYGGAGANVAMVAAICGLDTTL
VSAVGENFKQSDYYNSFEDNNINTDYLIYVEGEPNATAIMVNNDNSDQVTYFYEGAGGKF
SNYDVPVEAIDKVDFVHLATGDPDYNWKASCEAKRQGKGVSFDPGQDLTIYPAERLKQVI
ENSTILFGNNYEIDRIINILGMDIDGLLGLGPEIIIKTCRENGSILYTKEGKITVDAISR
PAVDPTGAGDSYKAAFLYYYLNDKSLEEAIKFASSVSSFIVEKQGCQTNIPSLQQALERM
NSFYDD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaccctaaattattggttattggacacacagcctcagatgttattattcag
gttaatgattttccaaaaataaatacatctacccatatggagtctatgaaaaaattatat
gggggtgctggtgccaatgtagctatggttgcagctatttgtggattagatactacttta
gtctctgctgtaggtgagaactttaaacaatctgattattataactcttttgaggataac
aatattaatacagattatttaatctatgtggaaggggaacctaacgccacagctatcatg
gtaaacaatgataatagtgatcaggtaacttatttctatgaaggtgcaggaggtaaattc
tccaattatgatgtgcctgtagaggctattgataaagttgattttgtacatcttgcaaca
ggcgatccagactataattggaaggcatcttgcgaggctaaaaggcaaggtaagggcgtg
tcatttgatccaggtcaggacttaaccatatatcctgcagaaagacttaaacaggtcatt
gaaaattccaccatattattcggtaataattatgagattgatagaatcataaatatctta
ggtatggatatcgatggtttacttggtttaggtcccgaaataattattaaaacatgtagg
gagaatggtagtatattgtataccaaagagggtaaaattactgtagatgccatttcaaga
cctgccgtagatccaacaggcgcgggagattcatataaagctgcatttttatattattac
cttaatgacaaatctttagaagaggctattaaattcgcatcttctgtttcctcatttatt
gttgaaaaacagggatgtcaaaccaatatcccttcacttcaacaagctttagaaaggatg
aactcattttatgatgattaa

DBGET integrated database retrieval system